%PDF-1.4 % 1 0 obj << /Type /Page /Parent 70 0 R /Resources 2 0 R /Contents 3 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 2 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 3 0 obj << /Filter /FlateDecode /Length 4 0 R >> stream HUMk9%`Ì9 ؃C5a3-pHiiztsw?̡jn޳rhmQL$KCYc[}6_fj77ob짆@to`!fOsswH߁ʎu/ߚ+Q9/p$ G`R,ނb}GC;= 9#COzFNq^gdYmҜ9y,9srK&%SR 36l]$ml*mB/[eU> qX%=Z; =dWEu(WqV9%.rۃ5:}T'ڂ9RҨ@JCajA.TG^GH$!wl7gCL^Sb(<6)F>N\ݛW[tRM}ҒMk+Z ,::}#+6J'뵀ΒrzjOWJDs=,%lMX  ̦Ӭ?<#/"! y҄8“#q}A]!OaCˠB/z0vcaU=kmKoeTk+ECL4E7qI"glN?%L)ײՆYkߔ(B# smXg Q)N UӞ;I>IdXtugc8_`ߨ'tM#*" ng⧺]|-gkzse}w:)̣~fo> MzLsG+䜳mm5}OND endstream endobj 4 0 obj 836 endobj 5 0 obj << /Type /Page /Parent 70 0 R /Resources 6 0 R /Contents 7 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 6 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-6 49 0 R /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 7 0 obj << /Filter /FlateDecode /Length 8 0 R >> stream HWɎ7+8$Nw,blzv.sMXv`kb-=_^]ӿ6,y<^6nhgq,Fz#4gChLcTC pr<7 7k ʙƒ Ӝn_^} `/ͩO`<}<ܞ>#N9:tɟkdPHH.n>4-]K%{4L(2!cE=cQG), 0KppBbHXLºh)F*q¦|#I bR;5aT1HU !+RÙ$['9IoSk `f;rV >͇#p [:wgf%ɟ}1;Kv ;@>eXx?=Yab.3@k8OǽiS6Qi>rr[a*h6BflbkӪxx\Aqj%a3?G2ȡ|ޥ* ecU*>E|%”L+ڞuR{:=h˜~A ZSEc.Ì2$[H%]1G+buU~PcbǤz^5[9 LZQFN1:KtХb]hOu 3T::ӆ%ܑAL <}|rG{~&u)Xl[ Y,>+6ԼP`o Sg5æT Tkntkjy.۷5QnU ~բ/ oV*nү nwT^,5fXW7ˏ@U|@E|Yu4:!aE H꼄TnrZI<AʰI kk,"AK/B1{p&x}\eyo{aV(tt{vӸrshBVHu sa 8ފGQ#@j Ҳ}zq롘彘=&MLJ;^l{dj0JlH%eI=+_y*r~ [R3 1p`UJ%  I: tId*LiEf،Œz0&p!ꡡWt6T'B2&JdkBbs}3)AT-Ɔ[=QZfa6`t{X\)`ds}@{gҤvAFљFW WzVx3JrkGZnZ]&`dPpB-NR׬'ٯ_pBOq0@qCtjoGi혺GHb*1{ne(XW+MQWNm*ߨC薆?2‚A-r^>[GoX~h!iТt]ڠ;łz:DqZ-&j̖)Y1u)&dHYifcn8Q0MtڰO^U1e#$'ƘU7jǰ9eUChӂW'=sy endstream endobj 8 0 obj 1737 endobj 9 0 obj << /Type /Page /Parent 70 0 R /Resources 10 0 R /Contents 11 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 10 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-6 49 0 R /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 11 0 obj << /Filter /FlateDecode /Length 12 0 R >> stream HWMo61|0P)xoA% C~)Qnė {25y3ސ{x ]~Q>(OL6$||{tw~ :O\wr{x%m_HoΟA ]${Cd?Ut%xS|GM8ı R~*/KUO#mZm[rY) 0p~ endstream endobj 12 0 obj 1222 endobj 13 0 obj << /Type /Page /Parent 70 0 R /Resources 14 0 R /Contents 15 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 14 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-6 49 0 R /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 15 0 obj << /Filter /FlateDecode /Length 16 0 R >> stream HWMoF Х x|C @{ނ$hC~g48h,aEDKgr`W&<Re28!+b5\| FO\szx|z M'/wd/.|^ht2*,#9yDڵ4?Fd\JPq挋~H`*1.c īť|K}XL-NP>MV$9heߨ d@"[6u\o&"=͒PqR5!`8lf!.x2.Y|dPC>>ѵa +iH Nb!<\\{gߣ7 X0@33L %Ȩ;{kof R%cB j mo![^+$(0q)#C+V XjQzBQ^bSøkCSH3Mtm;Zbs%EC9~k:{U׳/gݱ+r:m:݊51{'i=[0olI#SwSq.̝K8K&3d]r<6ӟ@?o5LO\#l4*&X-_ϣO ,zr<)*mj)`bKI亰,!!K3)EC+w`ʾ`N# h?UPE,]{K cOLfR WjQo2\03S$t*dn{ap Vj1?y(.=Cdm7tP]Fkub = +.B}V6CQFvkJrɴH# {k·XA! 1MJ'h5=nw˲Jβ-gnmm|}#+"v+|4‹Ýp7hr'}W* ZcUw^7L3l+UJq`|rM1#1f6͵&iP5fVԯHsO[R(BNTZaZ96][˽5tQ``O}у`zɪh-anf 67 a\.7 'Se$8="ch4bU-D DͤA Gm@&L }@Xē9=˕ iCQ[$7m!ffWzEr{ɥ҃߉ܩ* #t> endobj 18 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 19 0 obj << /Filter /FlateDecode /Length 20 0 R >> stream HWMDWF9|HHpD jēJj6v]]ի "j?v߾;n~ivLED6`ۑ.7iy7ܜۆ?ޙ( d7wDAzŹ9 v{_ოb.6LWXNQ}"[B,b{r4_<u!3E{pgk@6(&!fԘ]M(&%Rk+m$jd+i-0Rl -{ɲ =ÓNqѲCXH2&nCQj_yv|ڂ5V1ƶ}TK󳜶t$ОJ#+>4G`*z<6953y %Vj"oR蟓grn' سC Rp ;nvj9tXwtT%6K~bg$uz3\W^Z*O[C6C(%jw gmS {7:F#|8Xf E1!\K<ߕvxYC W^[\[d "u]兮}N$H>Xr/ɒ.) fVuQ9._.>M(TE0R0vB5`'ŔG7x?v{t*e@ֽm)hw\/PB.uK^8US 5x% P}9x@=`ЎZ0g~Ih/C)8whྒ}I1[⟸jeDA7 M( 6ԥ6vc=BZt-Jufꗓڑnd*%U,17Xi6iE.ȼ,h%u!(r ATy8CAN;'H-wSPB(0t]}WX`GTo])52Dw[`}MXy,J,U̾xiAa::f,b̳g+H.{ w-6ZŌbZ:>NFZSKCn KpC2Hg%Q= #I~) mQq L4Yچ qCa\Y ZH/ ׯP2^f\:k8ֽ[8jˢ^F"t=ܩ NoU!!0 J]k-!\)ɕAZ`}# endstream endobj 20 0 obj 1827 endobj 21 0 obj << /Type /Page /Parent 83 0 R /Resources 22 0 R /Contents 23 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 22 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 23 0 obj << /Filter /FlateDecode /Length 24 0 R >> stream HWM6 ϯ@RhIQbMvnA-^пGɲ=IS X ֖-|||?n|Q:}zWzb01.'q,u{cж肍XO?\O?}u>]9+FkRghuF8wױ\a?᧭r^lǑn~!{C,?#96HƁ7!3Exǫ:v@e6aIѸVo+>']uE8фC,9`&ldaG0D[>H%k% ^>sw1(p(xb*,g=q~'Bi Sd|u#>Sȉ02Lr ^HK3x8 br lq g{-MȎ=sv f24O/Q]z_Jpq cosRDjLѷ;+z~ٻX]L¡vI9/V3*VWR]uIt;߽S`H)qs*BmBҍ#mI]x>fea-j5 Z%M*vhu,ᱰ;Fx!sԜk%)i?2M ry0&5ܧS`/bdit4#%P2(UUP #;M!{((q)ސCw[q0NMLH11A{ fD@Ihrp -6(&"D 4 yn[:ńB!$8ua)IAR6S* ]PpcPr\K $wJT@ 8rPSӪdc '6@ q]<gA[yA;WPjn<U(l*sJn7M!?R6 ^{ 1e;K4M" bmjΕj`-hT f5ф$(yjcƦnyVK&|t=v۔GTsMtqvjvLEFiZڴ[H6TնT}FjH S \5 zBXu9dچC +{ 5cT&[ʜ~+3X4J?}v` $CJUڮG?9@I;zɛ5xT;+qꐔbM:l^\0KŅPcum*N޸0?ʔ 9 $ Ǫ]JHL,9UiCOf!CrPFEqۺe?~l\Pņo}7:EYa7/ҁ{*F քwYV¡Q^#(p0I:G7؅$L#|h|PG: > endobj 26 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 27 0 obj << /Filter /FlateDecode /Length 28 0 R >> stream HWKFWl9Ą^^&{ 離-Kw Ʋꫯ>fxk@6|><;5ؼ6ckt`rI65_SlΗR/_Κ`5OoQH05!_#߂f{! Mt3C0 `a4=w\Ja@yIxV\;I$L)Z1A9&)PQM 8 Lԃ'D@&TxɸC,^v xLSGxX_`!X2zRD?xHNt. sl+6fꑒU//.n ӠS7>"oV ln]=>/V㳱ο% 9/P/8x)'%.[膐mhHŴH Dx^ Jd,U.u+)Spǜ RmV-+ۂ_sD>Gi_ GEDzsEgc):i"MHІ9,r )ۗ׏__?3{\I_sUT|q J.79[7[\GTo#ѽr>u,ni`DOCuIk9Ybk,poЗ{xb1WJ>#[|A(bC5t\w}uTk endstream endobj 28 0 obj 1516 endobj 29 0 obj << /Type /Page /Parent 83 0 R /Resources 30 0 R /Contents 31 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 30 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 31 0 obj << /Filter /FlateDecode /Length 32 0 R >> stream HWɊGWE0꜈>X}u߄FF#\G1 ]DeRO^B7t{O??^}6x+t)UsJ]\?\O?]zY~6yR˧ӻ(tVNbʮMYD9[\))n LCJR>6N`F^`Dp%x 8kgz;$"`&j _v}']Xn #_7+Hvm5xkMߏrcj$VMB_9_Yu&`۬m(bBo /6Ʌ@Pfxm<# BzNJH=PN72neETRm듵&@kS!it یI!MV> Po8+^}Hn4i,q/J- u-D!qlLBx$l[Z[IHxd8!k\ňzcߘW]R-2: XJ -V|6v׾XNj=έ* km.,b֝baw2w-8WқĻ>tnRv}t'|CIÊc[k-cg~' L endstream endobj 32 0 obj 1606 endobj 33 0 obj << /Type /Page /Parent 83 0 R /Resources 34 0 R /Contents 35 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 34 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 35 0 obj << /Filter /FlateDecode /Length 36 0 R >> stream HWˊGWŰO),cs>kwd=5c>Xbط^C7v{?>{NLVcgv*}Owήz;Y<)r(r|] 7(trERmLt!=Y8` d|-&m q,HvR1*y-_?=%츧(͊#wYOl3+A'LuRԇgɂ/r-O'"*6f xHBI:kjHBHr>Gq>&URrKW"h{n m6<5@xHS99њ%5COڼٲvڻiZ  "HM|gvPf`Anj+Mmc!)uW~%rIburLn!t!ɤN# '㶁VtOe 'HK7hFTBh=䋸։]q Z9CtFKtOێ,I$>K# mzV{K 4L,L9!EWV!i3Wq֘BLr`DnxERp+Evdק Ad*)63mIMO0e19O*W7 iQ|csz<}z<}{0z3j؍v&=i~?kd4Iv2i(lgi /Ҵ&-L<ڬHhgJ\& %Ykqe\_->.D:+;m[P0w?|zc|LjQۻT$5nx2mcvƉ,=;ȽOט\Xd|-a:|h |k } [lfo䘭0B J.|S#KnvC䔀\2#[AC `j٢NGwe8HQLa= YpZd&Q`'"u SHm69~ֵD> endobj 38 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G2 42 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 44 0 R >> /ColorSpace << /Cs7 45 0 R /Cs8 46 0 R >> >> endobj 39 0 obj << /Filter /FlateDecode /Length 40 0 R >> stream HWM6 W=DCs赹=Ȳ]2>ʲd2]0H>O_P_6D4NO?j?^O<9\ &;D6d7!aۢaXN_NO?e9a-_Ί@prz4ڃiO4\;O]/6Gwd,BK#晤4k|Y2xyA?^4;\f5:096Ks2!e۵Zd#'03.+k;ɒyU"Q"iTH@E2͔%[ϲƷC;&ao)w0yip jKc_:&~khO4ωO&0kvL I3b;WHY, Z/$a-LqngNeԈELVchBؕ+[ډSnϊYwmgF.͠Q hi`:0cnoAtdx9lP6"+k+,221w5 aje\ztR{o 9J4~;Ys EUE[}1 65 Kh|Եl׎ւzT#E$Ev Ԏ"{(>񵔨wsY!d4N*Ls[k3OQZ $G uH͏jZ\3Qb.^d`Aw Œ89Qg$Tb>eԶAfb5GM  * b7`ڬE/:j3-Sigw3قCv_ou:~:Z Z6ȡ9fWWQL{mql`7 5y#\87SwC3ݙ+Em8Zّ&-%**=W1y?} Upoʷ@{ 7uqk}sl7UQ\h_ naTPyjŅ6BԮCjSh :ipϭ)> endobj 42 0 obj << /Type /Font /Subtype /Type0 /BaseFont /MHei-Medium-Identity-H /Encoding /Identity-H /DescendantFonts [ 64 0 R ] >> endobj 43 0 obj << /Type /Font /Subtype /Type0 /BaseFont /MHei-Light-Identity-H /Encoding /Identity-H /DescendantFonts [ 65 0 R ] >> endobj 44 0 obj << /Type /ExtGState /SA false /SM 0.02 /OP false /op false /OPM 1 /BG2 /Default /UCR2 /Default >> endobj 45 0 obj [ /Separation /PANTONE#202685#20CVC /DeviceCMYK 47 0 R ] endobj 46 0 obj [ /Separation /All /DeviceCMYK 48 0 R ] endobj 47 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 671 /Filter /FlateDecode >> stream H Զm۶m۶ڶm۶mۚs! С a H(hQщX18xqID IIIII)IIiɐɔ̚lɞYə\ɝ<9ɛ|ɟy)B)\")Zb)QE)U)S%)WPeTRVYZU]:թ[z5_iXFui\&iڀf iވilՄMiӌiׂ-ЊԆmҎցщՅ>]ۍ~߃=؋A܇!}ڏa>9Q=1C1a8G0i$G1e4S0m,1c<3'0k"'1g2s0/8* p:fx&Kft6|.+r>z!kv1떰~)i9We%[Wm5װc-;ױk=7g#{7o3p`+q(xx;Gvpt'vq|7'pr/qz?gp q0p(q8WWOp$Oq47p,q!1)_9^c_^~{=~௏>o/c endstream endobj 48 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 394 /Filter /FlateDecode >> stream H m۶m\m~ټl۶m۶"0AJ0"4aK8D"2QJ4"6qK<Ⓚ$"1IHJ2"5iHK:ғd"3YJ6"7yK>S0E(J1%(I)JS<H%*ST:5I-jSԣ> hH#ӄ49-hI+Zӆ=H':Ӆt;=I/zӇ? 3 c8#(F3c<Lb2S43b6s<泀,b1KX2b5kX:ֳlb3[6b7{>s0G81s4g89s\2W5s6w=<1Ox3󂗼5ox;|3_77?e endstream endobj 49 0 obj << /Type /Font /Subtype /Type1 /FirstChar 32 /LastChar 181 /Widths [ 278 333 474 556 556 889 722 238 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 333 333 584 584 584 611 975 722 722 722 722 667 611 778 722 278 556 722 611 833 722 778 667 778 722 667 611 722 667 944 667 667 611 333 278 333 584 556 333 556 611 556 611 556 333 611 611 278 278 556 278 889 611 611 611 611 389 556 333 611 556 778 556 556 500 389 280 389 584 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 556 556 278 278 278 278 278 737 278 278 278 278 278 278 278 584 278 278 278 611 ] /Encoding /WinAnsiEncoding /BaseFont /Helvetica-Bold /FontDescriptor 62 0 R >> endobj 50 0 obj << /Type /Font /Subtype /Type0 /BaseFont /MHei-Bold-Identity-H /Encoding /Identity-H /DescendantFonts [ 66 0 R ] >> endobj 51 0 obj << /Type /FontDescriptor /Ascent 752 /CapHeight 737 /Descent -271 /Flags 6 /FontBBox [ -44 -210 999 872 ] /FontName /FIFHGD+MHei-Medium /ItalicAngle 0 /StemV 58 /XHeight 553 /CIDSet 52 0 R /FontFile3 53 0 R >> endobj 52 0 obj << /Filter /FlateDecode /Length 223 >> stream HS! LN<,K+p(B }9 $q 86uggwu%F%KS6SӸ-c9h8jB:bRW4 t\*uvr@I!>/j=xi JZtY ͧC c_TR-4eR!TTI㇛E|ğ!  endstream endobj 53 0 obj << /Subtype /CIDFontType0C /Length 29977 >> stream FIFHGD+MHei-Medium* _f{I "cr %t $ H[l{AdobeCNS1(c) Copyright 1996 China Type Design Ltd. All Rights Reserved.Monotype Hei-MediumMHei-Medium-RomanMHei-MediumSuppdefSZ[]g!,Jf;S+INFpA"p B    / 7 ? l p # K   o &68P_gM24V6fX) 5\5^5`5a5b5c5d5e5g5i555555%G ";dQq(1 D  _ v $ f4 #<kHm !&"#$%u&#' '()*+,-/%0C12J3$3467.79: ;~?@ABC_DBEF%G?HNIDKLMhNZObPaQSUUWcXY[\^]^`_apbdfgi0jlllmKmumnGnxnoovppVppqVqUUab\vfݮӭ''x]JF[aWG?9jm]XUWbzV|]UggxqfUmfttssektxxsFp)*Noc]KI]?j:,{@DF  pa@D,{j[K__D61cNo)*G3ID9&CHC͌G͌Xhh"IPe9JiRJyvz~mGLd{ǂ͆ˉ?BS, KMX1C88I9J6X1\ytx~"V.7F|z~o\y\Kj[ZKS]K9#Kit3R1dYߌLpOs~httoi{LSRVn Wvxx&SF#cc#1po|#G/e)Mbk|Yt\la^PSUM_]U?c]ZDE}CXoqÓuxu{,j2[8cGZKNXtutV]iaghN4Nof@3ilmn-GLlccg8K\Z $+DZڱXzOMARyPwW[ 9cRبճh42y8kixp~QWTB^Q˽˶M?>=-Ay4w)R8?A}|Ǵɪύ +3B)\ nxwzݢحӽ@Wj$0·Űˮɞϔgx^n{{ˎseN:XKQrn%M.; hD<CG?>qM-ZcacFIL9 @&CΌ ;όKLAMbeemxprrqpluj}Yě'of'xC"?i_NT,983Iishqewx{{ϴǶڻig>#,E"=2m|u@,H-N?B<3WHH.H]@N@+jФX:#Ez}yȳ'oBu}~^]_uwvNLNP~&Ktutu]G?̀ln2חԝҢ|+[4x>Lߕ)yPt~{S9.}|NARA?ù LF/cdV,r/,Q,=/1M1XNs)b-5Ha dBdFdFHH//p76w=zLlPeT~UuidQhwnmfKynqVoƢ˔wPƩڿQCssoxq{pzoxla`]\`xneߌO|vvvIiƹbKQ9d7É" ^D|,a.)Z DQ<kH|xj^kL]xay\{S[J\PqXuUvXwWGPB33 ؔ׌C4}@6P0}6z{;{;C<:$DCQED((MM&Q&@4!7$s]F& bTL.6\nR dQiQ0ǽ֗FTRWqinXZ[N~ڍߣvx|,:J́hTیΔMB?tGP|f{srjOeba\hYkhsd|eyR VcfjP?]=GjFi>y8MW¦_kbnlgmcy^nfc{|z]dudYiQ-rjllqjRyi`a`j`ބzyYtuwv62 n`S)#$ìDiTi.lYYYXmZ뾑3{cR+vV.wvw`2OŒ// ^oxxy֝ѪΰĬʶ<Ɋ>[*&zzyukhD$bo,Dsru:[ orts2T{Bp:~<:}435K=P,- QgU% DΨϲļP^mYtWyW/P-~ usuM^3)cQzhJc4c2N&'RBDO@YvͼýgdmrhřȁR~WxVTdlvuwmkouKqLcS~0W[H_^weZP΋K\vY}c}}{JQ~NOv{w>EFpzdM4 P 5e0EcR1.![8_p8pP6zzz{8Pp6o\~\*G7 6 ^ Lux [1!d%*r'&YLX(Q&s!< &$dϿձiɌaMUŪlgQky=5WSN=.Sp!"P8P$PrwiiiMQ8P"h~U~LhQ^\osMOGaF}E|D8zGMvdwqaMtaXQš"kVVħx{t~{Op\LÞ=r\YB"h jҊw+Kk^n]l[qAҤɸƾIVt5@HP65DIP@c:pP}iexNSb"fayăڍ=Sry 4y:KTWRvS`QJFßweYy]-9^D9&Pa*<;}|{̸؟c(`aa^"1xwwsNnY\[>wurzywx~uwn`\P+O~ijkwwwLC]ʊK{>n;<J;I<R! 7 cRKQ`%f#lxwxݕߞ֨TtxBEGa`eDQXLIgJhy}}deoqzjM?QCLKO@mKaN~ymwWpOj,|#k-j kQ${|{pIZ7AVڌǐ׌IgXAD`On fUJi-nP΢Σͣ m R&`u~쑜0H #|>3zA~|]a_uvvƒƑˌ'”ő0ŖȔŠGXD\Nb}f|e"P yh|jrk[;8C=YWҼƼ̊ ebedff<yyrvws|z|v`Y~Y|b`Xte)lxxx^TPxgux@(!?"?L/QJ}Rq"83,WXpqrw{xWINKavTjKB]nmkOh~kzspq]]WdZwTiJ~KQƗěuvnN_ ZFV 6xx|˔{rywy_eXG%,'((,SlQ7g=R%(%)"7('"&%'%%)%)YބArP$x(R>6 q\UgefQPNAf]60Qi^^j]nzfxVgU[/*[ɽ)ZM*.*/MkOl OԌ(zb^Wgha[PP-S=P>6ʷ zI\Q"a?D`Ŷʸ]][T`XagˉB@9rk~pl|}~}ҩЬҩWuTxXr E&q:l=i=_WNibnuou`kGVJȪӫڥ_\-Q@P@JŒDŠŒLQAŠZZ];\ [ s {xzw 5z|{|l_ZOAݮѦs\XGY}6}GO"fDKފ#2|ryvwu|||}ycoyO&'MHQMH$O#9P_dlxt`yaHE\gpQFZͯȱ^dIIVIk]ǟ_Eqde]Yaqge}PKj@JGITM˖̖̐B*(7#]_:>5U{hwhwlHy˰=qeWfz ]M^!O"z"78fкԪ_^[Sį^5;Ͻ״UdGXBSN&IT[dQEw{|C  w Oz{{{ z  z { ̼ʼ{||zunlzwabpo[m^Ig\d^PGYJH"QrMNG^@fi~fxe{yz ZaIlQ=?@*a\D˞$ǧ)+MhR%)$)B{|yttrMQSzheSj2~J~O͌}~dcduuu5VR2J>1uQEWkAQIJ^JFی^`^_`^VrybkcJoKnPX@v:oEh3P>EH_"ESnl^z~y_k]GF1cϽɲ\fDMQI^aIWǺU tl %K HPS 4` m5g9a:v[Gy?~}knnAWJ̱ت٧|w|gfhK||)P"dOdB~`eZAA\KAZ?JNB\^ӽ͸^pê².X<XrsII8N8L? S :8T9; RAR:7S8ʊ;&&l<&1ԦԠT^-R%aHsrTfrgdjG ZZ)}xthiQ@qhhu<m)FƋQwtgsfM㊌2LYOJQ@OJRR@QR<ќ@hyro}]axq0*&g5W8eCjCgy8-}/L:lRo9QwŢzZ!yyy2,4QaX[j}zъH~~L&Y~>r_]Xon[\qO͌yz~q~fu! f h({,*%NVEQ9RyŘC+)*EgaQbQa_gF}L))Q)*)L)(IL))jQm#QYz[wY|z{{.c|^vd|w'nrSu~hpzxx^`bLĐϑČdQQ.]k/* gyLܩձ©ý-(ked}rx>yuww2TBKJj|sv)yryr-M6?G~hfbêxĴŎi6ȽȻȰzf3eX~kd.$^.|I֛Ϫɠs_tPdki~{I**,%eQ#@y5fFkP_[[Yaжi_Zdga^;:N:Q;$UD1ʝɰʾPwv^lIIQQ]a/N+ʌ,<~=O.MIM6>M5P#GO'9o++=jR;+,=,,j;++EK>#>+zwXe@lML!]gj>џҟ@&Ŏiϻ y$-4fU`ZX`\YVj?`nŠyhmj|tumnoM̒юˊnVT.!TxZz\h`fyqfwxxy{xzy R6'gRgnWVŝũŒ1d :fR'-R7&7PbM4bc/c)d2deb!ccg5JKyNyxziykwk 9lklL~vLQ-9.:gF9E:g;AECW||}ѵ|}~fbYbap^VnItȷn̐McPSqXfjv/3r42 MPM Q 0Q9f>HO>hZdt fhj<JPPnSgSQ\b~ZTaypGNf_v[VSx \.;8ky5e> MBB|ab^[v}xwwiy(}+_!w zzxz&Q(kF =iԸͭ8CĊCÌ b kRmQqq͗Ƞhz}l3}+vyv:hj<ˬɴRWY|]k&L.oxxzұ‰̎xw|r~ĜO},{{zrps/NMsƹʤ{yxtKZSOc_:raaywzm\LWh6ll`_~|u`Qhu!~,X!qR 0Q,Sv)H16L{{|˽˫BFB9`Üz9LMJHQ-fbfwtx9>xtUK=5hX]S:]GOS}{n\eƩ~{t,k_d{wq*S~Rp\kXsfjojndɌtJ>R/Qнͽ ɡ:Ȓ ququVR :: : : 77! //IbbFbbb:bKb8*"kYЊzw|tu)Qi SПΨŴh TG ZqPfrnl/=L-"3!#\b^ P -\YhHU;d8tUݤ۲dZuiGL=9\\ƺƽƸƿú6/=OU7Y\<^73&hZq]nY6ͣӝVd,I# f ;`0z.UܸeVP'kkMDP\pSoFH5FF[GFHGA6[L[LN"6M(aN`Pd_sYv_u]zx|qsgO(ZLUBW>a2YߚfQLyn^>5/j\{ſOܟ!'ejrI˦Ǩ׼ZձHT!:=SR"}MSa"T#ddVe\ffWVeefe\M>lPmN$nj$AQ$% o{rzrsh̡wii|{\iyi_RGi8FD@WX1urtusvHR?^>fYU9rc\Xh{xtyyw=QQ=Q^`]Vxvwƺбz}z}~E H^qZtYxx}xԒmPO8ȯeDdLWγiX{,y;USSA W7cQ߶ejis@W]WX\X&3d\d&e\ef`dҩӭSXQgKjHyYZWfYr ^?QıĝNíŵƷ!z}lgRpwukQEdtiieC jx|sxmN)^[*@1\N\QnZuWxXxYxzmsoM/cTu~drOek-vgcx=nP:S0'\\%&%.%1]NpW[)G ɊF{tnRyuqqJZ1<2_7]^HTzFnMWU~nji~uw<&mkié~~z:yyzg?X:>Z{|sٿƺ` LK@xvwS>x^dzwSO-O%e}QΕɡɡh_qp^_F}9rpohWWM9yyy~WqX`gd NP\]NɊ 66*YzlcoZlL5xzxsstDXnu|΄$)7Şê{{ycfZiV|}zIFǚR;Duxu~{zu}}z{z|px}y|y}~{z~||vwmmisis|z|î^pgޟ$wwwKzKpRrUpU``˭ͦe]rj~RQhɞ;Q}c~jtgpc{~yʃR{o;r9m;S:o7orrHƁ{zstьRUQUjzzkkkQK^ZJMTH`~x{̺¸`xb\QGg`]wyu^dͽPO̽C|O2,'~Uv_m]`l@gklk/o;:Nɉer~z~xPPWEjErpopZTˊNMQBPNAPPAOQANP?O~rqfXLô77|sjVduw>̌4#͊F ,{tp.'yƺ"ɽƖ*7ǞJҞݙI`t~ut3}}+d&Gl A&gs4w"Xy^s]ctZqSyygQpxlkE co|owigrls?~XBW(PQG øĻªȷD0uxqkO)tKKD P  Q  P #4]4$-7c/Z8|6!l.~uWb`[hznujfo2vvSweefַܧUp6IKBT_DV>OKQҟĔΑ~|x mlYsy|ycedĸӲТW'tV;|:fC}ЖލIAzH̓zVX— ľ ǐ̫ĥJaˊЌRQՌ#"ysozclwzvDPӌCӌCE f[`bs#DQW,<QNQWĭlƌ Hƌa& & nui\a=R.wldZm^QV %ȦI fVHLDʌo-|z|eaeI$6"iڌjyoXWbMIW|bxcuedGUEIYaQ:gQnFbIP[d˥]TsaTUoVLCêxJ}YaKzğQnRNEȠldTuǓǮNjƭ*Ɏ pwNb7]Qo0M"O#OJ}|TP=_Bh|z{OTG# «ʥYyɊLɌ5 # :!" (ePIM#*+ڞVq6U.f,woVqjc_OmQtõƚʍJæ}tcfʌFGsxvo7^9'3::44HO%jhemkjRVZ]v<:b@RϛѩЁj`Q`ZYȌQMOwUiJCrDRql^bwdjko|Z\vbmgq[_teniu|]`vcjjj½ºóA@@/[]ZY!zrdZs~w{YVY S[(cabּݮUc"R)55Q`?SAJLMףәaN`\PNÛ|oU}!::rrODySy[NiZ$"6#%U »ȡYsJ[PZXc%MZPMơ{p`Vss5'Gr1z{quxuxvuTj)OHBM|RX/Y[cPC}V|SwV~NBWbff۩wl,%}!ɺ]WchWhƚƪĥƎǧǒɑxʹ "=:PSjjzne0ed%3ed"ed@xqfKkswL&ɌIR&Ɍ@[Ɋ` Vt4YA?Mg{|BX?i7sYld]ZXWɕjl&@%B9f{ksmqsdfb30dQLfOq[ʨʶbwtrnpj^dwUTș̗ǞʝǛxpwywzutq=P 'GOwwvaxdugxlNpqnjP>wwqt4O)wqMovwv_vdpf|whvwxpnf&P5،lmPIZaV]MrKvYҡѮ½֎R{z~]ęMgiioitQ2)ttX4ihW.JC>\ZȖܐ&mjpx||7buapcsZ3f'fŘâţ•ŖΩQ2`E} Yv!'.? z|}{}{||Ůȶ|}{{trxwy|}}z ݌97,~uvwyxvpt}{{yKmQeS8̊ 4&RFh}m|l&RR/1QQ(RQQcK'Q(zJ(I~}}~{i`V[[RAʠȺĹä4ʷǢU yJIYQozzzzn]XNJ5YVZ H})"ϊGMx™őVxj+O)ۊIN2%O3HU^ P]Sy|xS1>׌X>>׊!>"AAI@JOK]QWerc|du{{}ڳ>uwvPn0;]kc`[ġsnWtM'žY NSd<<<=^Y{{wsRvNvy}x}s}{2QsPԌn9\7>U_":T;:X;<sU:;D-@B8qsqany1cNcRl\._εڪQȌnkfë,yNBɌx@NJrQr[ջ V ǿǘ̗SF   >  e   @88f1NO3O0&EEMɰfɰf=ɳɌbJFX^[Vf^Kmhe~|ªxf^TmOL_Hn8Qܕӭ̺bxxw|FjFTYư̆1J>8eW܃tXIiŵݷ¿\'_oFYTSU\gcelbmZ͖͔͓l~uh^u{|b`b`~t{ozt8><<~F[Or9[NX_.5D4Wf]]h `s}T# Qv"~[Yh[0!eWQdSq\Zm~|}xY̽xvXl)bjFNMQ]VijefdpZ̖ʘΓpuzmYy}~dddʽǭauzp}x-v>\}nYfb_0kjgws]1%[cfyhzv^mBg`zy[ca\݋Q|ndzfĤ'݋''X(DQ1Z/=//=\iTZH33Fz]Sw^iWW^wzXvcwcRjIQ;6KJ8U^uXv?dw?*dCd:trX'=P>!(-][{naTEށK)&KA4@Y~Xv*c7sorg[FkQl@Z m*XK:KҳֶϚx\`JD.'")ͯŮyK{GrZZr\nUHe}@*2OJ87SX% ̉vI%$DlMgxg՞kAtjTF^~u<%' X!Nw(`3lYP5!92ʽT= VC65S XD);;Bq_jH0O9/$)- <;'/ -ĿiZvhݠvVV&ȜÜksqMawct~swYS>G/ & t & u~$% ! gb !# "EG | Ò | endstream endobj 54 0 obj << /Type /FontDescriptor /Ascent 752 /CapHeight 737 /Descent -271 /Flags 6 /FontBBox [ -29 -210 986 876 ] /FontName /FIFHHE+MHei-Light /ItalicAngle 0 /StemV 58 /XHeight 553 /CIDSet 55 0 R /FontFile3 56 0 R >> endobj 55 0 obj << /Filter /FlateDecode /Length 435 >> stream HR=O#1}u" DhK'j* _t|%-?a@ eJ^;kiײ3o޳M>Ps| MOkxFWTs]Ńx9 3[lOixFrqqNpMO/@,y@g+'͵t́5@Xn8-1teq6vaP0[M|H a,Dě2Ԃhg\Jb sZ5űVD[4$g fBZ RL:hFڳ=Tz8]Zp3y }4fxݖPC~[> stream FIFHHE+MHei-Light. nfnI "c %O $ HZjxAdobeCNS1(c) Copyright 1996 China Type Design Ltd. All Rights Reserved.Monotype Hei-LightMHei-Light-RomanMHei-LightSuppdefijSWXZ[]^dghjw{}    !$&,.09;BIJM[\_fjmtu&*159;?COSVi(+/14678GIJN_amtvx,7AFJY\]klp"258<ABDK_s|  "&(0=?HLQap $ 8 B q v     / 7 ? B Y l m p v { }  # $ * K L U \   1 d v w   6 9 V W b n o &-68?P_k 01:@Aeg| 9:LMQ]~#24ABGap*/8GVaqD`mr}6JLXZ[f<OX  )4Dn %GB !/Vb%y`N6 @ U N % dcuZ-EF"UdmOyl l !k!"N""#$$f$%b&&'I(()F)*n*++,,-~-.///01-12_33w4z556B67m8.8899:w;;<%<==>?M?@APABFBCD`EEFGOH>IIJKLaMMNO_P7PQRSPSTUViWVXXYZ[/\#]]^0^_|` `abjcBcdefghijIk7l$lmnopqr&rstmuv1vwx?xyz*z{|v}(~:~tA;WJnT?6 xMA>WXx!-]j5#xKnV|-AwP/|qjGKo^2'B 'z͔ϼ >}וD+&<,")1\m_(=}bH$GT$CV\yD4 D 0    3#@ !"#$%&'(*&*+--/001-2~34567x8::<=N>?@BrCEF GXHYIFJ~KMOFPQSOTUVX Y YZ[]d^_a.bceg5hwijl5mBnp1qbrsuw xy{t|~D( KW{7\RCjh-v|YYo5nznqzqǸЄ-D3@cZ[hh_\YJ JSFFSSFFSYbbYYbbYV9A9VAqtuypˈ9Pta=9=90I0>#STp&F>HFB&0I10&BFHF>&ppTS>#pJvJVeVRR#VdVRRVJJsRRVeV#VVRRVd'JJeb.GGeG/./c~6R]s<u,|-t4vZ@L|]JVYĂufl rm)7&;H,} 9\|`}6:t=_%9nʳƽ6Cmp)}~}u{|~z{sccKp9mijo'(?=KݍYOWQ{7S),L39A5LiQXj_]L~S5AwNeVcdeD9K^;oQA w6~QIgf@wFJLvC##^b AmemVe ex\?xdK8Y=..qlVTJy{zcAItfa d`A(x1P"җԔО%edq{Fvheč@!c!fe"zAo`*a*AbpB**lEi`((941.`443ckq"4Zm/Az~ITͲfn?Q>Q:X%FcE|y`nda**Tdm%߹%ohˌǟaWkWbx?5d`-ownbaiiz% !cՊeLI<2K"j1 rnF50M< I/튌a\`? 8^4ivTPS2 0zmj\7Q;KAq뜢=Q`ي%2;ɸɸ(׿挶(bZ?KBKIROUWKW.JctwvyԿ bNSJWI\eebnkyuvjjd[bL}~~e`e]Ґ[~RvSxS|܊P*Ŷ;slmm<ajP\LY]SVF]Kcductbxj*7,#N' '%(S` `öpeiQjfXnvhk}Tj}PiWx~H͌eYW]r,6n,Rc,ҩԴ\? Q l+|~cmdapeHT`T>mI:!q  @:RQPrnmc{baXmu960lke/ .-t(h`+U.I7!r<3=)Pvd" /pQ 1/19p%S@ &qrZXXw;"Re7S\-KOcb_`t$?\#,i#dp]J6+ > eB "dL|GJ xm*J+Aj1nwjhrQaayAe_g|PJa'Wj ~lpug$퍷jxktlv5*7IE]Pe/AGL,^&;&V~Mje2__Q*x.m2~`YU\2ҵȶK!kk}|+`+ОϦͥ~}S"g$mj˘ʚɜcZ]^m,%)9kjz%},~Fr@2)p0B74PWJ`En0Klڿ=I]&ĽծФ~fhQ$2;(AcY0hEw] ޥvywW]t *$h1\,w14 |â̟ .?V8QMHkn D%*8.Kir_yyseq]aȋ/#FE;msG:;%lV'N*@1{h_K^EkXP3ú÷eaCųOO÷I8%^%$ POd#OMK$y kb~xxEQO\넯Byͷ@>4Q;>lpnppjPfsy`isՌblcJGfw=:5xvyz kD-vdKбQ<iF**QϱΌSm*s"x$XzNgqPeQ)e(|}~~iqWb4@i"dlom#&1ͧާAOaO d Ac&$; :Vfe   4S"d\[b%730I5@PNJ]zTlq[WZ g  Ab=8/7#IG-z;+P["V)RҲ!^[XhdaktRdrR6 $$ 5%ZԊr%}lW^\aPcˊܜQluu^nvuvvX԰_Nж%XlVTVx[j5E;=Qn '{zbjdNNf`_OJo4װ`_8e ITf0}zy}9B1R0U^ogk~~X1}~Vemkk|}ܦ(A`SkJJ|gǙWx~~hx~a`}b|xwQPvW眊{VsF3odӑTN[LK}gq֪ԧd{dtewg<")Gkê?{}}y\na^]}GdϲJ}f;t^^M]]swwghhf^fuXTPdbόbԴ OAn,'y-biUA q4U74"77`n|Da o|n{m_(`PMIqn]VUIճccJ"lO1G.&!u˹ӭ"Ya4c4|y~~rbdfmM@nsJOF^TMA8Frrz)ß>1{+ols{_RjaȖЏʍҐoFe0ZQc`YzX|Zyi.imЀǢ]c}FT,аʭ@,K@I;!/qұQ*% %ST\NS]zG!elReWZ\(+@Ko9f9]XWX.0fŊfa`\\a MMKylicY4;*_Za_aCO1CaZrhD̥ϟjY)N%+xĥa=ѯ0;9B8B!~}}uo]e*1fhi;RR:RSb99a<<7AA3ȵ`aa`-4/aGGյLGb~}Qhb)_@ʲ"Fkg]`lobf^4@d#_oH{}~z^qbѳ)mbd*!d!*+)T)dd8]:U@xw{D'ފ,Sq%'eja''SΰD^DΌeSe6!L#u h B3o{za\}}~wOOOOuMMMMp&&,2*܌]!dqpqqqdXSInAu@*^TASAAJAJAAeAXAYQEngbr b z}~|g]e] I>.iqrrnE9>w]obnaqflhogvvwswudu[UWg__lwVfFreOZX)$JQe$'k J92h|/lqba^}4f$ #+@88ksiuhoi!03iKSa N!ݿjY9N8KD`>Hmx3>Fjndodu*S%\"hi$ ꛗ7,5?C.(~YXWl&dwehij# :o<;_x@z}x^m_p bp ^U x]&tphe QRxVqX[+L,@9~~}ð0ծآcfoee۱ɰɊ~~+i#w"bua,ְKд^¬Dˬ٧~Q(C'&l"9Rf17mhW%V(95rĿ^xo[`eʖٖŕĖGCf&b]ds*"Amo^׵ %s}}D{{^Q}~|R`a}R,I2yo]c__bt ehܬ޾ٟ>qvnfdb@teK# /=m%12 ;$840eAebfϰbA;WV`_RbRcA'"kr_ZQm3((Xi u7ID ba}xp`_n0aFmd;uut{@7k۱jx.w.X;mrn_W\H%';*Arh/ēʓYPV%'sgc}'sx|[n}}{SNUC \F&VlD< "0sOLYiviygy&Y#e!ei)#[_k$[Mm:JKBE?Yquu[\f \Pfl/8A>džcuLpMfRuO6}}yzmVek ?lNc16"ddV4 /FvD40<0IZVPwkn^^*#G+Wj9A88f[h'01," *iwhshsj+$;t( 'QQX<=RF^eh>gggL^հȶG/*.=.Y5%%ԖȌeWMXf_oJkiSBA**)*ti?  {vQ[Jo&<TgmS{er|}uupA&%6 s+yz{ssp` eMb]{]{]{7cC_yZ^zhGlp ]yVr^w cg^v[wZ{bC~B`b`e/̭Ы~xVzWuWeN/ qʺeO C$<QMCC4e-1[~f~ztzKrd^[_T'cP$fu)Rtnl\;ABHLpϻgdbZz o [edd 6е&/fZĥ̛lQeY_%fmM|ͳqgkmcbaek (m\Wh1Yrw"? ^b\UE$nrjeg!I@Df$eBU d~irbbÍ?m55g}\z]w^dM(0tܹᘫCȺŵŽ2dZ`UfXd)e{~~{pogaM<{ v;V ytr}~ca_=H"-`.e{zrYp`ݍ2nb`fzRQLm1J*-toLC={b{|{~WebHiL*114=r(59.*becg} D;D63bhk@9?',G\:t+\:匜Ǐg\(+#Ҿ|:.e8ʷ`t]tG!3hb``qonfk0h~]|]}^9Ma荒Y3O4F;`u 茆Êa<2t3?!A8j>?Auceqdmd4b\c`Yc!s.0B@xsqt , *BJ~ACe`dZcYKqItIvaݬ,`šƢŢ @3Hp/5N)Ԋ͝ϓdoIV@60{&.G69D.Soɮ6@Z(a@P`qlpb]-}gCIi {%)Fdhfhz~twsXo53tbfD`to_[\FMFFF'FEM!)d|SzTvUeG,^1JFmۊx!6~~}td_^C"!!!?j9w:cn<}}k^hYpZqoq}ncrse:a\2Oaurtb 9PEl G+g@'31(<<cdbfe9[h]fXm'459o\*nLBeW{vqqTS#a܅ݍǒƒ*i 1͚͒˛mn x(OP4@4A.jdyJtLjPy@3B{fpc%Ǣ̞G>3T=tƢboIiL_Q@uA3>GgYSqcekglegh!CP~z~lkkV,mt`b[r{~{rGXٱيbeY:f~ϱ97C8L~ɡduItJiNg88dCCn77Nuv^ kdo95*D-KleX~z{o]]`pl) 5;r\¹-?]&jGge@1?b?&?' O^>AdQfS\bTcm9&e}D+{~sjCvS>3U+Bcfrg}~uOg_`WUWLHS'W,a<ѨӤUUoJ>:;=`eoe6 26eph[4E-1!rīȨ\Ȣ˝  fN,hAga]/W&WfxjL=>8"+t.$qiC=?OͷN:ddedd S (+s6=슌@Zǟ˞e^9=-uѻ۹LNDAL}UwWwWng`X0.pвAM{~4csdOħ˦>0 HФҠkSC;vpta??vaAf?feFf<)eLh ]gb<e>^[awN#8"ι.6:;jIH|Mcc`s[j"_2" qL6m;he:b`_hSPlwmmlChZ#K12JqwYji@VklpqVqs | Le\#e@5g<@߰ߌ%HFe MpnoMMְ׌GbGyke$[&B4pM/e/S,/sEdre6I+(JCɺW2X>:F (Ue%=h k5)0.l 3 6FHGU: ++xk+j.l,1k$n>D,TQL>*A{IMرɱX*>ec$RAzάҩ#BzjQhdNhcߎa!'af[wZuZx}]y`s]y,fD9QMuKzMyfoϯ)fF^-`,^V[vknfg:f-֭͵ΟGtp~g{vw\w~fihkp2_W^ 𵯷AWՊƎɗA6i&6 ]$R)y3> ,m Vf\a$bDEc66p$.= qiupqkjiLvhsiqi}ӌh`.lf6 #]k9rqqklg~}}YoED*j3R`Rzc{Cnd02=9@)P*]m׏f>~WnBjUshI(ް^/s#2e33A0B ]!blA^b#$3Pfg<_8HPTUe Of|awg{jwbv e }3Gvxotjsمs]jr6)twDd+#IjaL}_rRU4dǟɚ Ԗ̓51a=f5`ybm`Z]jrCBzFs>ѰgT">'1:uv`Sn"mt:.!nu^W\mF޴S  #qqC88p$!plda_~efzW{x<x`VvgfJU\LakɰSjw p"jJi97>qvZNi (`5۰`c`ifj:I{;ygsrss]  Gn,$BA4!(/4vdՉY[\Sor[XSPd^TWrl_\UCfsιӰns[5.0%K3N=Dtnwtv2n&L: 3el+suvv y seo}1{!f28C4C+Uc9u7<#\bđh}|zuTnbsfm}kmH?=unURBrkmS\/"Kx"  rlw V/-ieѥKnpen z{h ! !!6!  ` " "gұ'eeR''$_NRNUZrƿȹntnTVJ`IQspc$i_Z!A,waNQjxx\YX:=߰װݰ۰ٰ^}a+ f =.9f?!f#7g&lude.\< .a;}};?Y7AٳZVN0D{}}zdr_ *Z?[?wtyhcjkqcclad`gekh`hhkdiNH@GF@mnQX\YXk[bos>~>ktKJ2_2=}~~u&)[Ѵѻ˽qLZN\Ggnx~ٱ'e[*  n2/LB4nqJڱ&>IIb}|~y`rb>ҡԞ~b*]*/~w2khi^)904Igb+G‰uegf_b$G0j)t3j8xggwpg`ö5O;2N }|{f#12;2m"-&9,IQb^Ydq(Y0X2vѢZTTpjf[d~T(I-t]ZWX] 'X$f7|}y]ndBfhuA_FOSlħOPa8fe{|tA_GNUk§ǞQS_=dUշF|@OO!}{}!!_"JdJ@feҊh_ՌUՊDoLV$8/Vl20,zkS]LuUE66D96WP!e%Pd a!D!b!`:jDEDEzDUDUnz6E6Ez6U6U>z9E8Ez9U9Ui4d`^e\g+pkoqPEB{ K =Ik2,OeҢԚbyT14fuqPLoxm litf8=OCZh~";_"d PfaATEBXBQdBbswzL~TOXf.l:\AgE[MXM.i)Søǭfy[ZW}yye7wspg|`]]NֶͷQtM_))4ُוԗd{z|zqmid Iˠm||}'a,p5f]dvWrXmZz|{zv̱ѦgQmMJFvmhgz:2DDX#22gg,u:<hԫ~tlk^h_;OdOvdvb}~RQ{4?b3@Kb?z?z 䥠'5.@`_b"7꒓h&*+8n*f8zpe`fhCcK6"E K5Bx?66K!\5[5c_d"GŷZC"bj iunrpsoe'|wt Gmpg Ǖ,O9By@geh̾ɾ;vg#]IRaL[EEBab)ǒƙęk quE0j: fϊ(, P Vh/+&~jwspwswq<gbc%6uhX}fLWwnsY4@B:R~ؾޱjieIw u \!%ڼ{]868YMFlw]YZs}~gML(}{|ह:FO.xKF 5!lVbg~neg 0VVo%򌍎\[ +?'c(4}~yplf`Gʮ̪ȲZg ZqXqXsrps)fTH-ϵifvtpguhdcU8;T⹵#6vCwvyHf[4?S^UZ~Tu,c!)`mu3 upeei`\H44>8{xypoksonjb@AkC),&*(=Z,-ݶl~l^i__8|{}dcWkwjBbD_Fxγ׭e }Եx=y/y~~tPfRcXKdK^FFw|tqe~~6&"= iiG fΰ% ԰be*skn~fbbkeތ"(e(gf++!ڲnbnLkPima{~E- s/`5ffm̟͛͗hd6q)|d=ȻDZ) ^~ bae*(OHgK[6U9K>pT{6v5c?lqt~MNRlBUIVNk/ST-HUHSHSe%.8CC4W0flDVj.1EԿöɫΠiS]f~i|h}5a5t  f E,Ѫߟ؋k1W2IGI\r~]4C=FAۼWW§mQ5"1,p`_""_QOOxzfd ``zy]`].‘}{sX uΝԝ6]d\b;v9s<}ڝޚeSF1h [{aiFhG7pW$]8OFyyɄ҂ԎTaTg *>5/H/Iq׹>AWjixb4=#P%YlِARS84I߻ZbA|^v^vaxǢ˞v4`4o5T  $0 DbDbMcl8`7HOVbkUc˭Vmaz_tkeaf1f0XnTtVse|{}ojlae<W?Jl?6Z#ЖЏex>u?0!v)'1L65?>GڱK"_Z{zJd[$s*zWWUnjhjx!.hHLe o5W4v7(@%w'afjl[icx3J:_$/H T;>7qphhjxVTR}3]fg.X5 Яզۢэِ:$)|*qltw}|efg_ԓÌҎb` rXQFL6CvmtiB*+nq86"OZuR ;YVZz&D6;K} z}}\mcYYUU]OḌZ^SYT[6ZOZOZ̰Z&A{~g``p&w%f1qRCATASfaA_A=\Ɗ$-5`XZeYc~hmp{yMRZ QK~Wz|}odcb*~.h:UAcp|z]R~R{'7Ar_%4A A0-$%b1d,Zf~~ĮeavD<>Qe5]MQO}S)P+  "?62I0Kۥgdm /a)L1VZv|۱4 !_c`!h"^|a~ap1_9P?l@lfemw[[Xδδ}TzVoZϝԞĖǐyuM ҧ՞E" F޵Ȍk\ r y&0A*o,a6oRNVrH ( .]]_(:5>LeuvyčbT@[UCzz~txib F5 e:G iqop3w L(­ĬālPeShTx,A'\[\^[\twp`Բ >VlSlUp}ҵӍ_vbo_vwaw/d %k)yŨɥ @+ .} { T&O++05x++\I{ e wweɌc;(YMǟǛ~ldT"u}uwqFaM+njƖΖ~~}QyR{QxHfT_RPȞ͕e}CyIjJ/>Pzh3w2[HM~j`tdqNMcar]`jt>;5RxcUyFfI$dfef#hk"dvKK gKKHKKKKhfwkc.<Ñerc7#~+Qa~5%#(~}F<=KF>֊YWsl7?^bkk ;߶la"g;h1%5'Aβαε=5jiYkb^^!!bgQ;dd"2SƱ'ʲ #/B0c7e'X(/B~=cl'8"\ZVIklpss~s}`eu }S)u ʼn%^}X`|WqwN;үvN㸛DjFfaad^be@B,Q1XkFTT77Cݮ gt=j>SNPhlDbey'|~z>PZQ^hswwT N&Yfnzr_ueb`avopno3X29FðǾobQTYOfVWwǰ b gff( /JoӨ˻̹a5qc|A~WX]  AlQ99y  '!{RQ@QC^dzY2y2K~JZWWpniizdtg;gEYLNRe>z6 :rź˚w}|Yn ;˞Б.c-i`ڰdg@SFSLobdc]kxMGJ^!ȴP^ĉ$DLahy1Vzv`,Y|L\<}|}q`eevhv=jT`[cXQKNljglWggalgTbW]\UNQkUeW`[UMPgccin1e>x?{>qFkuzjIISc@VLIQoO~jUcVV^Rab;\\Qosvvsm[ϻ l%_uϽӸgV3N4B=Ӛ֔ՏFK?H9]jҗ철sqsB'*4ʿֵd~o{pwqnl{PkdhhfioWYa9O0Z.llةֱҹH_glX/D6F3iy__^icJoo~fe}f|u7P^\UktQPK`4jLZN]WĹʬO36WlHͣ˧˫ogb{x{NFE~|׻.dG>2f#1}ysTbKkKqd{b~ezhGb1a8HM}~RTNR|yMebbroodypih{jxh{%jaig]o[s[tj}~pym_El 287̴ֳ_ض12,_-\b\$b#^]<=waw+b,wWoWlUuexxEd exeufw[ ""_$b}}-bQTRRojig{D`ݰұyUݲ=T(W8c:n VfrVcmqih{j~i}yw{2//8m ydy1e1q}GgӒ}}}}sojbNkaޯt04N_x^yav|mal-e-z(Se}z|gi^qe%z)f.LfbZJ_bSՕԙРlrjk?'YE78Q6{?v&b-a/x7:?J2090Lrp^A;<^Ue`a|bya`Gxdͥ.+CfM!\lw鏧Ḻ` jbjLfL`'vUaZZwwD hilA8S4"ʗϔctEh;<0|ġ˟ɥ ;>+,B'Cj;>dyvJcd)kN,j*@ (L]ʪ h`Z9*ufZXWwspxghD6a,4~ǎ I**rou}{gkj^s7T2**GdRfcklmjluđgUl]axѴ)<;|Auc\lcQWrhylg]R{|%f||Cf"eٱ!ϯόb!ohexgxjfKWLVXu±e{c^r#e!27k#*&&%be-UUVU7 IA1" vqehMGtMses>d>Wd4iKJtaMMJl6&4.JiD9;9nqB14F]jMqsZXSEjcRZmq][RXa <tլزڻP%%pp'/1:?1n.WB|EEc49${sRcRdQi}ׇŗƖwj vjeleL]b Bp п׹mY^WopYgb8)iMG\a/uKXKĥÛ%Üŕ Ɯɘd|H|MtKe] b>~s1w5s7~~b\aa5^~]}_@|]y_z^p]9rnog|`^^ZYYutqg}NNL}xwfZ`}ϫԪgoIB&iX®s@ 9;׎|*|f9Y9Yc:Y:Y4;Y;Y%eEaacp!# 6%M&qGH}Iphlhdjd^6supPXEhFnkӬұĵpkibd^śfrxambgia``so}`aK4``wQRߊh~}ߌg5Xz$F3hcUNMmc\kx.,xax:t(Ѵ:`5>aihhcb3twg_5_5uza1e2XX(bTdU//3>4C8 `7edo[D4C4CCD9494@445544  jZ[!ɵ̾=uh*(e[Y[\^YwЃ{z SjseZNMaLfEDBMH]#A]Kൊ]I^H]~e`xxo~d`a8FfXe&eFDﱳh綌hLfhDhE|qrjzl[^|Wwej}sVq`6e5XfYطwhwhokChF 7EoYZ.YZZ@YZW=Q8Y.tg߿midhOD<:vjc!S F`GmhmPnceos`aa~z 6Bg)fG`IXNkefgq9KCGUo8MSGʼn,+3NĞɑӫh+x`xp Ia-0mdDB3"#eHYyYp_">?idd>DEnTddTe/e/հаҰtKFYK&&gFEfFF#fϊ~f)qgee*f.a){YUx}fڊ+WTl 6CP6-Iqa^`3w"fi&BYLDDD)DDt^xk`TKv;A9/ӱdegfefj~g!e=_H$ %E!_CЭПg[.7/qE 5:E'TV}ES S ai8?(+fdhgeh&&A-bo'W(I(1u5ҢԦj3#:Qf*{wkyadJ G(9OӲұ -}A8JGJG+}b~bJY(AAd?g?(a_e\&X$0aƤO+$Qec P.-2Ya`=P4c3ijǐQaq,-7þǩelVhRXcW]pfk7Y0&~R`3D*Y#iklПk )O!diC/QI's6NBY\i ݰڰ˱ڱmwV"9*)hSa-""K#"<DYa j&' %7*Bwv|{qoswu"8DoePڮ=[T|ذo(C&4o!(|cygsh1~{z{oth^CCCCCֲjZ8OI>Fs.MEElqMBBϰp}67^65+PQ`eaa4660qjvopxuwzqk:U3a2gi7ٲ۶@f1 l- yxs~}pmm"ϻommzwsywz6GX*)@3bL|~+[xgϱ; C L ɷjIG?Y=^rqdod̉ 9 ^blvuu(WZnE\4F4Jϵ33E4Ejwnlk);g8D[I!qqYTM9NLFJCWj$'8%e#-a_+qi ?-G>Q챓tϷ_ m}{qvzpeu6i~\{aqa"M9cx*!3D~utqeB>YYTbPmEBAŠ'ۊ!a9|"0 K Oj LM6tFǶ ^pKSTW #M2,_ʹϴǿrQYMaLgry~H*qpof00p6nan,e,o+G@QMPkgcƁJ_Ͳ̳pn!֯ B\_/0A~~e _ 4)wcFV9B-T+]l,CqCcKTPdOoВ5Aa__md'}"<B rڽ2^a_&tumZWWG۱"ȱ ɵP*L'}e(cc!a!LfRl{fSM=J,zlTE"*Tjv{bk~x z}~Tb,ɕwMC3%c&>9>dI"bKonBtٷixZsas_[_Zf`!Y%P)bs`rcnc(e+ЙEspmi|qppkZ}ythMJLG>vApD}՟ؕe<_ΆрfGGGN6F1lv_t`sa\[[hdX I)V1N4D:l❒yvzzwli|sqqOfʼβK$nnB@e^>8jlkl#\'9:з2;@1I $DyhfyytdPMM1:t?u@|ןܓf=a~viIFFtC𳿲ZZLadDZCZuquyu{sspD3Zc\}xz|FNd1kma\cW edaQݰ۱ A2AV@vQARAi{DQ~vr)nl՟סӨ{W$i&s~•Õ{pgtqmB" e OXVisgklulf eFi9)"}۶]4e7nlܺm866zlihca$5>з`40R(-./_.-c-(PdsabmƐĊbEVL}@gB^Kk˫ϟ Qz'[PVXSjy~k{yVz`XvmogF``l_mF#dzȴD%bs~~!~zmRbŴJ}%xMc]Td}ij+۳\IRS/E}L(+&RiRľՠǁ}rP^?nUy4|[oʀ~IISrG&ش0& v`[]uoori,d,{03Rv`^bY_Okasl]cbӐ˅ 'feux|~$z|?fBEiR\;?z{|`L⊊f2~|uih`B]bi`\_eXksQ񶽷=;:jdsVrXd\<_<)jhbkx_b\n<n7z}>]pgFgHh';&PͰŵ뵪˵g,a**e*|y}sA?^Gvү֊EhEmwRDz QQa&*_bn{x|uXkaɋkDpnl^Z]iT6K\4A=G?sڻk0r]TSVSLÒft'I %q;~|aHiKHBrmagrsemKӰ˱BK_w`q`vgkcke}\s^nZygzxsyad1woOgVfSfeh{wuBfB7`EaVo&%b Iʹ*Eڰ\|d' ##t!8r!!dcd"f#^rZf[xj|6}~~Ŋ`t`sjIC?N-<_chƛCW^-2:ӹ-fjJfLVUVih0d6u=}~6w7jLcMaQtŅ~~TTR#utq}YVVG֮WW{}|wpbwdЌJhndnf~\oWuZt}(HKe5f{I+8o .>0;{,OyEPTpW|hSѦئjr=m>`E{ShLMJ΀f/dsrjlyLKGͬ5:-bBi4c4jӭԌbA;;::1::#d99199#;@@1@@#k::4.`Z`<``$``& JD۫ݱոRfi64?úàیfc-;8C?t\ff;X3e2gk wQ_XVfZejrw0֠՜׍ch9Y2?'vN_T.>52XV`eUW'52IlʱF$MERs"/E ]kݖm`_xsy,%!֓܊a>_[Vps_XXiObR]SòȮ'}uLhQdRŪǤCMcN_]XVlse֢˺ͺȹߡJvuyJKS9js󎪑}~}=|?uC_&/8Tjmƪ˥~oLjNhQu6MvE&jFcHaJ"ҝjRdT`VsūiB^ 8ԴH^FVHOo"f}#Œf}f}Bz}zw[jc#IH! I If(<p@`O~PgUDgZ[qq_]ShKdO\SvŰȯk|tVPWńn[XVxslk| a^Vd[WsoFY [6qn=*mYCrKnHRhdaOVFFebʘXwuvynn}}wvwSSSe{n}mwp ªDŽpojkulfefgmaZXZVhlcXYj]akq}[RTjp_[Rie| ,`B f XT!YH4;6XT!c-R-\!sgsTg%;%;b%4%4H1414b1;1;1}#Lg gZu[qYxjk߯^cWʴBqmƎߘ~~oonrtejg{px,GUm.n`8uWGi8Ok.f"leZvVzV|alkgievosnni)gQrOkOw652zj{vx5t6p4xgsiei'v7_7y~yzo T}4JHBװθ)b!Rke5_8N?~fh gh ?r Pe|IvKvK#[Vj׊ZZZ}}}s]da̖’+ fJ;b/K9N:r(fedusuK~j8]gDyӠ۠kX̀ˀgIDFtj[dc˳0jk\[ttq0U 6jלhN$IAңqlo{~zgzco{Wcg Rg|dxfug}^&wmgI~wu~~~XTUK̈́{~~}MJHHH֢ݐd5rAhB}C>갸 <޶ڵCm]5W;P<1L'dadf-,&pjlky^^\yfy1QB#3(~l?pf}rlggdR9oB]Ex?{arxP`R>M&*.9hldmdt%8nF]^;;GΚگK]Lf}h}h?a@j pN/}~{ B?\>\p5d:MBMgl>5ZYWzmoa{-o@sipqtt~hR}z|ɵΣfwX %+'/l _౎ ^HŶ|zwrrth!%=+XlClobgfizF 1  V478e7|}}|'I+ [VTV[R./8U`VeC̱DZ?ϝWFc11=۸3e99E5B%`&bjB[cLONjUbfr|WnezuAhCj>HSUfm0?o״@?C?Ba#uqqb_bcrfFe(f԰Աұ˰װ̰l]Qv_qAFFDFFFFBFͲ͊_?fJf>gJXYJdefgMYf? \f]JZVVurl-^Pƨ˨ɀnEhHdJeQΰ屖@GFm2(=HDpc!f1nEO #/$9qFF#oFF#o.FFoFF~spW~,)yOG9g}ak}taifoH*:$|@TJL]sƭ؛3g~2w<vu a ^e]!fY)3"ND/l}jjtcgf6J*O ;.b-}e};eݲرڱհudgo*+!!>dab;g5bb5όx}g~AΌfjgsbreodt9jukkkfҰP?7¶ȵoVfD_#142>t9OY78U~}lrnf^KKG$$a%]a'*f+ XT%UU%eXWTT\\ 2קەhp s'avHۯׯʯͯf  ʸ_4kHG z-Lg?L DE̐lO")tYMKr_|xtwcfeܷ`M#gR ٯͯͮԯ",2*MKPewU1g&qJOhЊ+fonb_O_){=/KeKe[I`I6^G2>TH++Tڌ9 دԲTÊwȨԍ/fR\WZ]qXbeU^eSTv[}sVjcAy-m.[7]qG!ch`fCCb=h>vhh ?hyToWqVxrti|^^\hC egevHҳ %[QH*}}pcgb99SgfbumqisnUbb'c}&v%]1_3U6F?t#3rlҍ2Jonl~}^XYcccAĔdm:w_us%snn~~SQPVάٯl>f@VGuIl)ٱ˰Te'(~65 D,e&fZu]sX}~}|wg{id  Xy  nbnfΝ@Nhktsv=``)fOMfˍ`%H nR,3l.\eb=ha#h1`خ?bkkVllll[ll9X-Ƴ PƙŝÝq&`"is;vQxQƶkbQ\RW[r3nokwsxfV]pqvh81M1*11111hg}XtZl_[rhclxwyvvuudgdԲ]gghOoh{jxk{}}|hH"xme|a[Yuײ4TW4BRcȕf{Vp[k]dqfd~f]`mDJD*DD&EDushhy\XXyhzXnZq]}f0:-=EE...d..^(O |}|ihi(d#mmp&ddBAQBklʮȼdWRLBAZ]7aldh*d(nmo3c'o:@A>g~մͱk_YVSOH@YuðB{^U}a7fߌ9-f!90a>{|{|9|{J(f(P3 `}x|z`rb^M^Nge^d^wsqegai.v&8jLB oޯڱ<6"dPSPc80f$U[l$%(P&W5]d+9dc8k .c|rcX[][`vplf_[d\\orI诟IJ%ƒɔd*^8 r̮ΥzYu^s]x˩ˡ9Ng&dfb$ege?h@=9bSb-+n5c ,'Do9#$3kUJg`~~wykrgAsqkmu`[^n@^FYHqѹҧjg8# c-aL6;8=`-a,f, SgQY--y8rp܌iq zz~lHl#l#K`]\qrjfbbv mqe`_ jX"t,Dx`JLy  0`3LLW O;põŰSfL-dob^jxKJEdxoegzVQNL~rmgPMKIRgx?eG[MrǪۣ L 5LL6) K  L @)K?L L 6e`_nrh[cF9 cYpa;'B+~h[M+!qҰbYr)2=l&43s$ !1ڻ -nkgeLHHiffqrpbktypfv1(ossUub|yeb4`GGfrKgOlN{ȫ˦pHywH78@Hijp[\R`Tfru|nT\qupvozsyyezRRV0dd$fmHXLTWegcntfcbKTAfCgj0[[lewXr]o[{gzuxg|cbbf*)N`Ȯ "Vf>@Fjtnpmqswxvusjipmpmnkko}|}zovwi3/O|z|a^Ut]{ilrlsƉ!wtyhks3oXUS΢gu_gdgh_`]xnrvnFR9h;ljݵf_Y gފaWZTWaehc}kgeLXDaCdoLGnLjNP{SwyxghjaИӎdKK>mMLrh !kMvv!ϓИΞqi#}&e.ze{Netshjw]WZKn3n-}-~f@&f$g` 0/nձ’kc۳9fRеkQmQ^Wǩ/o]ciylaY\`a}e~hX}~iljf&$ RmݲtvzrǖQjfcT[Nt.IŗÝrg9w~d>=g:tF<ر{:iF{ Fq4*ZČho@bIZK|b^`tnq^m0L9R@x`]\wopkbHe Œe /d`Ff_zwtjg`xKafYoxZFs\²I5zH|||Ftdt([eS_(yY"L)zohf}lllVmqdu`tarc\\\Ų̋ϗh_#^!<4eS6N6C>kU|zzOtodVUQ9iyvbommjej/Vc7v;nByؠޒ0Ɋ]w#*Ohb)!f FZ&cA#e#%^Y^b)bfbEY4 f,e, fIH,= bqsq"f"':4Vd^)"e"9$`,^e^6l980F-K@]]_+feZ#*5H8\dϢ̩ͥ'P¦Wu(n''re¶ԲղOgpeq|xw'q}KMoUR;0g4riۡخȏfo>qemmuZYX;dcbnrd``ldmTmUfX0@6lвZ­T͊͊fð"V8k\bmsZVSGggfv\f[gqphkjwbW])}f^ fe8s"Z"Z"QS7S7S7h%gݳ_O`^]srniys? .&CiI& oRfo?$:&Ds-1p!2>q5p?BoJ?8,oҳӱбȳͲeor`*FFCFFFqFFDX@6aG7H&c/_oo6rr6EP1.+xjni`q궁+c'k'mk ޱѰI·^l^lJJwJJ_PPT11`<WW4c8WWVV.I7Z/d.njp 973ykma]j- ʰMH]z``__lCƛgjgH&{|x|NMMAMMMMxql`]\\WWpkdlyx0v> ?q7rCW""Jʣѐ&rh9iNWBVMl]ۯӯgތB<~{}}qkcerC;obga`bg|.K6K2(g,@SuSvQyg6LRB]E_mԷҼn(RRNrp_[Y(Yܷafdyfwg74_D%H)-+-AkoaERLMW 'no8"5lpbFBO=[9dnܴݹn0C=;np_ZOMU ɲnw7}2|>jPafhic poooItttttt t )MQEbYWnuz&jb%QCs@qqmmw\ZZ ֭֘i}9i@hA~zwgTOP^,NGM̈́΃hٰ˯ϰʯܯԯ;B76XX`,KFk=\Vʦ̤hP]$8y%g:Όiia>gBmhn:3qCc~{{hz:~srpiyljjeezbrctf}#eddwdph}Bj$~~ra"gqj\WZrmhlzrUgXfZylخٱְܯTO,?f#j~}hkkhxoo|p j t=>x@,_C?;vmc^S;T<]2i~ܾ%'a'R`8hrom4}Od,oLkL*䯴eK/=k=k?.m2&8G8G`# T`mg]r^u]sm }~}vqqeevaucxq nFLHHrqc`^4 SYL_QepɴǸļmذF#hvrqfxgdeae=jb~}}/j(o'|B:a+2%8D%eӸʹlcfgXgtzdddguXnZn[%vpq~~c`a,f\ ZfYZ&<)5@xyկϱ˱,Ȱ>UZ>w w f,+,,,*(n`eichli)FMѴGgFFGgAFGRzjl_bd`i&:C b ,?-Gh&# afrokdlsiafW,U`Ue֌UaV,d]_vqmk{#it\j_ka~:f* !S[j+3H[swkln"$; Ugtfqhik|wwqolm@f1f*a:D KnYLc~w:yuyliglvqqo(Gdg!! < !!!Jbjd}wuvfÐ$! ^p5p cPq ޿<xgff"+T7Ӭܧw2_e_ g #INr0vrmkx\UXcˉ[3eo F' ((Ec__cWCe_9vlnc{xwxwuusqgh>FimY`Z^drY]V}9eaWe]d@pH_O\PUIMkkdã$yyn~YSQf` =1aV6N:H>dҝ՗ӖYuqke}olnMgs hv\s^p__fR nkdĢerFaMZQVJOlk`âcoF_PVPRNL'LFE}n7~~9qAmC֠ۏQհկ֯үԯկ!޵C}~~v{vgsptkLKgNK$^l?@@N@@oD@@'@@@Q@HCCm'FFK'GG=ӭɲԲױ =Ṛʭɫehr}pfhig{RZdjbjak^pk|ÊIJ~~~udqdikOuon]zwwve>dAe_SRVt~'nb/<{e|P{O{O}vuwddŗ}ybkdX~Z}XW[\=[;_4rRlghqmkTɲֲ:EA8zZ^;gY~rme}~~lkjoon|W8f.g-]\`3fr+Q8O;ҴnLAЙ8H1d1DXeXWWD..FH­ɤdRAAQA~mymdհԯخаƯU'$F.-0w^\\+}1XhQ+g+PAgA&h0Ӱ!F#>-.$i$Uqr3Z c3kfkFh' FԥQ~|Ih[io'Q0D9q-:nB`Jq -  *f--`z`vbscF] ؝5WUW|0gАΔg~3mP EjwwUU8/0c"!f5yȰ6ưʰs-rfꊊN*@?UDrgsgWWTkhkZgZ%c^g3]]n0+[.bu$!ܟOf}fSGaFdEg__^so:L6I'尳Ű6-.9CGyVyV.+==NeN55355Le==L;;J;ssbޮ8bd>ShSJhHWhWPnhnIh;W;;Hczsekf!c!jt*cV벭˪Ƭ­ҫ2򰭱j(M+1g&I5i5Fzy{Nti11Ō}\WUtuXVVicif[kzzzXcV 22Wh2CCTCCWijS220HMnGeGekghruppjخԭǭɭ %Aq7fVMcp7KfDDzX9,0yZ23zY8H|ZI5vvcR$%O$$MB%%aK zxvh{ppnk10\ZZvo~~x-S*,q%`vxg7b_I7zbzfgf}wdhd&1b-gq-c@cvSoVjX}¡gBh|ZXT|pk6;voflw_[Yp`IIc)hqRnQdWga$GgG>|:x<`zhwLICwrbI4Z]dŽΏ`bevhh``zcUhto1f3a6qzwaVVb#lemfn\dabca@?>>Y?yxumll+fP:1p +A((2&$0'(% ]YVk^YmxW򲟳K31P 3~~5ypC+CF1' oƪʩ7roKK-+4GG$[]UUcZWrr`XYoo^^V!ZV=t sljgbaxm}pnggdavs Pedbzj|yvzydc`trl^LѰԱ 볰@j\,O&@&>K)&##(A""_q2re qA{עiM-8fh ..Z"00b"%b[-0269ǜȜƟiNwJyM{#fzfN:f91f>.*'pni%*]jn4HH=e{ٶ{:f:l^>MOES f=>=<>>::`2+K]k--nob7 #\ja5J@>PByToT_bnljnpqjkNS@f@oiɴѰ֯&25ٌZLLc7 loPiP_Yv"@fDOU0&JJ2Euwupngw܊Ic?z}zvqdclbQV[bYmT[iEGmiklq|{y&f!8Zbiӣثϭ(utubq2BQ3>TJBp\Nܮı $\[r$KcN$O$ _cZplhkyL ufabfh?V**}.~iakef0ƫǁgQ`OZ]u!f fYVUPsnj2wwQufl w{dqi'×߽l&HFBjb_koCkD_J̪ҨHﰜϱ61xwaR-H,G/ $ W*^._b:f]c{|lefm'+$Wk.:2Ì0^T5c^5H6Ib``<h.fذ_ffL/Ư̯ٱ.+\JeMgM+ 'YgY]]WW!!Gl_!7Q}nsjgEww+eE9  E  8%'!$'!*%!$z>]qonyspnffܬC񮮫ڲֲ  ڏؖؒ22;v;^Hx zl|qH4tznv@~ggژ؛֠t8[CvH+s1_;w{[h!nC^FYMpxY+1pltvkynhE!2G˝ϔҸ֤W8 { ;oky`]^;OwyފhL~wwR{;e&-]3:[qόdᱛkIeOW]||ïl`^YdWkqxˀC,`~}[uTnZsKJO+7 :! jAоdMSOPEY!R27oj1c*)f-e-:hfPYv\u]~fW?zuvgYVV@cײ+Vhl$X*7=*Ne"PefFniXfX`avrmimu`^\{" ֲܴos۲K==BZ]cs`l_ig&-qmw 3guopfwrqmd%WYlݳxTxvyq6pp-rr-Yǭ˸"ss%pp%-N]ic#j)jedroqdz2/|Яհί97رON3rQ"u%U*#duursputvvitgrk <x3:::{:{:$3$~²/[dP00AgF00(oqeleniw(lhhqxU ޮ𮎯ٲ33qrn8h==dGG&qJJ&h%JJq%GG%YYd33hYYd33tH܍+KQ3wgPS/eP)4h}~{pqebIwήدϯ"%&dhF֌JԌՊ>"8< <B^~{{oidl+p6"=?t2$6Colz{vkxwwvh +/ <2m66*lŶȳjdK`OXTuYqhhrrea`YṊ˯ɰμ³䳘WA[LTT7XJVWWVLA'UIUs!im|lb4zHA }zOXxhʑɐɐcxylfgplk5k__mxdYWmgk{Kozc9((X800NHϗщi;Z(N$~,22Y/A38HӶҹ87F9P] *  m\%krz앫* ,; }~~zC[9r9v׾urr__^iYChq^d^`jecdN3!ѯaig6>C:[q޽ӷߌ ruu?xqw}tݴߛtqunPъlp{l5˯~^hb?EGGUpZ[{_$GZ]|_.9f)@'c "gD  nuYn]fa\[]oq"(i`Jzy&v4۵ŷ55q˶̨z)f_~a~bf-,rWP)K&*@o(YABA@TFxqn~ca_V%T55,6655SNQAїٓ!NJfd -okݬïְή< Cs-/ttBBgg_-dhcHDD@rj#@@Q<QAAQ<*gl4M?MBwbhdoomR?hdempn<hrOcX`WvrqtxsuszrC|jnhgpfU~n||}2BZ屗ɰwⴾBHYSR99G|slcQ33/3Hޣm/u-y*>I^~`{bxh][Y~Zs_oa}T5L4 w  Ctsof|uutQOQ6#hu\t\r] ~ͬͨi`%Z&N-if:S8T8i2`,f~~JGEЀ}}<{诲˯ ,ߴв˲Ȳж_`8<8<!{ϳSSH,H,3g<|yqj}a]]6 ;}~|hvk`djC*o*gad2g@~g~!}}gN ʯX6gKHYӥôrZgYiWnpx|**65.Dng ?9ffg.4+X+XXIX%X%X=X=XT̴ͪikHaKaMxˮpohi|WPTٯүӰEǴO#g^Ÿț($%'l2d#&FpOhQukxxDGCwwk=wvfݧr3k*+.'e7r}ss{Ś͑ $$Ҍhg02)uood]6Y,r-pltFҳ0!F'5'Cd8^|Ohz3Mrmjc |zoyI=67f7fsgo6Pju{yve{zy8c, 9PUbèr{af5f D6,GldN˲˯ )tc+_Hg6)})**Z|xz~~~rpqhDpnlXWVc{iwluk!xvv|qqp!}HF}pup`2~#pI (2iǼʯɥplw]nRϊ/4>jgqğș$պٴ\gkG_K\PfBR*T'#EPaNߊ1wwurnf49YXQi`I 72Թ߸TT_ghpRjThUzCZUWloe:V~XzVe䉮,f!劊vf!fKP~RzS×Ǖhg>S@ll& g %thtu}umbqc˿Ըl^BXBLOr`YVkxKIFK]F۰ذ b-ZBKHŠ=aI0\rpqhʮohS$ōazz}[lgvaƵq^j]jbylCsmkkwwstx,YrŦmZpTzXuhSwj&ȊtxtE;Bq׮ՌNST|{tyugғщSi/a?ZIp7<Բϰ֯аNl>kxkyjslxoqsps>hcLJ9][Y+ e_b9a9:@@]Ydހي`7;BA6g&]c``[bf<<<_Q1g1"xsmp\<TUQsnhb_Pɮݮ? ;n"\)U-%""k^1Œ;Y`"ncmh}dpcubuivwxie?jxhyfvjjkkhi:a=\@c Ijh%562Rq hnppaaa)rqmpmpm%hGSfuqw}yzj|F"ήP(5ڱJ}Yxrs[|=TTUjlkd:g@(W5P<| 5Wdn i aobm^ujz}wzppcfvekkyclcJJaկncb\^^iytkcci^hrfsewkyg}lzzxxE]>k@jo֩԰ѳvus,L$_ hlÐXqmq|ncefуʑ?KKAݯίǯۮخ`-ڲJ˲G<vQUXVqnʪ˝?rs,}}<~pZB:?EYqe0,jJ>?Xab9c2@vpdqg_pYr^tg|{zhq`ga{xwfliid+gVg^ c믟 β c9tmb\LU;<f"zy|whkgc$&*Kp>:Ʈۯίį̯ ®ñͱ߲fdfX~E~Wcזslmu`nlz_igo)d7~KGGe# f,m(}f@_oް j|u~nglcI gIx{Xgg 66̳򱧱 761k3/U67*)BB}~}MfM$(nb=.m!99988e%s7KFEVvל7bbctdkd;VUTmlglw"ĶºkYXS]R]sn\XYtn]vru` ̮ͯ详˯ 궸>J k*R@Óiu`p`fglehopqliCfE0uvQ1^``b}kS/K-*7:~L[[_ʴ̫̚zv}Y`EecdknoLJb˟ĘȓȪȩ`gkGdBRTj"zYGi`RDgE,}s[oc]VVrmemynrqkfsplucB寳ů԰Ǯ3>CCLQSG3dupuddZhfeB"N??gO<<BrjfmyXTS8*h+kGcERNl0s< !6Ǽʵ p }(T_T_[bVdToZZrȟʗ&ѵ۬aQOLooqkcK&lK‹lJgHopogFD54kg'LxywvOrdp!llS{P~Qd[\~\hۤ^cT\OTVX4(f*ĮneW`T\`sRv^Vot^]XosMrNhRƨȠlUUzqoj{OKL_I8Cxn\Kdѯ )&ް0 Ebqoll{\eba!̸Գia>XP:So?U;Ru1h~i}"|iv^gj*[(@vڱ>ԝӝ{0R TTT TH0HUүԯ̰$ȳ, nL540/?9{xttpq1im5TEPDuijuwrzzwlxZVTt7ywtnlk  y[#v{xx~90il~d(^)A8|~lkiqwhab yfz5~{T}z(b:vo~9$itRkVfXx--D-,H--IȫìѬ  *x[<~PU_Ʋώ<ryNQUi]fiZlUuVup foyh*J)XXePSjR_,I+^_k_Ef8fV  ЫЌiVhK|wkҍ+ƐHkN*k)4}{hfoaoxgnjirqbpI(3϶ϵҲ̰BEԍrpnoplgEuĭkXkUqNTk}ftu{sBHS~~C~uOjS^YXDá wqjca]m^^jsYTQlccŊ=j@Gdڏgdfsuxu|t_̋̌A+cW/c;9xC{O^X_]´Й:Vi\]kv[VUdleI x 84/zݮ٭׮ݳնgy{HuR}ecctquЎcXU^y?@THlnåƶk^chW}[|]fY~Y{]{XPTƐb'&6B>`pëjgcV=#e$IfW}Y|\{&c&Qzp|nxqRkyX.yyeIįʮƭƮE[kcb Bbc)YhYB[[]\{Ppmjmtuot_jc-^1C<s016ǫǴrh^cl1d*k+rh"^inn*h\\pjujh[U\SV_nc[\Y F)&cpywxspl0cb MjejUST[ƈ{jPNM9E=uAsDԟגirOMKxqnfhm̫ϬɲuKfJhFpm٬ΫЭԬ鬫 ð8jZkߟ*mECD?]H<F~JYLzJ]]4Tj-  /- -4jw.{qMSg_dhrlbgpYoUwRm̕Ͱes{GJQ&^uidmjxgpsȊƍȊFVkVN"k0VWf)D.*"ӷ ܷ  dĩfJ{fI.$/$O*%*%\}Z[G$"_x@y6NMakR^HMm|{|̛ΔΕ|z{}tpiSa`aкdgEgegȥϗgfScLMkzyyɛ˙ʕ\|yrWb`_л~~u~t}vikjǤϙ~uyͮdBgZiֳC>Qt{~}{v[vh_ghg%}ztimfg32bBBOySRO{*BBNySRN."Bwxe0!i~3uhv3! cqqpmqsygy%_YYroceb@;dQ]wmmdc3T&N)@/mRnlgd_arrH*ήٮɭȮůٲԲ$g( <1~vul{wxtlpGnHeL~v{y~ww~~}O cD""G""!"@;|||d2L,}/G*&&Edcch_p{aL|76}gfzkiXMh[NG+/|9yurijldߒF>F߰ ٲ߳޳]? \]x]x"ղoAdq?p?H!$9pqnskrdd&;ׯցg>TDYFx|KAG`[Rj|cc~ad<je;h90f07ugtWIK''V~KNS23\ hl`41oGƮ°ձ.ʳϲXG2M0#e1?d3g>g.3gEJ-gEE|tgca8H.##.'.'eh%#$'&'$??>??0%|~V)/*..,/-//9/91DsJnKmLvͦΥisGrvhj}SPO]˯/諓Ԭe̳+Pi~k}k*kaVV? VV1)ޡAEEcCTHPNqͶΰMLST\g ƪf•ňh#\[z[f&"c0pnxң qqmZWY^ªK]*?/AJ͡շѬNmiGdF^LuN.4!u |àċŎM/z|srrGm튊pnqEeOVXsɮј,nspsjqvl_d 1k~ V0{}_ Xm4h-n-x`1y3c?DXWe irSpSoUvl\m[h_o}}|}o||{kjj˶γρgLutuo?uQnTmTuo_p]ibo|y}{n~~~mmmзұm_e Ҵ2{un`dFb/4 S~~~~.\!#$cmomcװ󯴱ʱıڵ-ȴ=eR|`mE\@@32' Z=U~T;,+ 2--ceF@FwxxJ>;M:Trջ͚ggkrcbkmlfkz˴ЪkoPiObXyԄ؈WX?Nrli~ghb'f>rndjwVQO~WsZt\|g&zui|][YzxѯȯЯ̯ɯN׵9ܳ˯~{zi~rooh^6A>ALs.I8M[FGo7"g"HZ[b 8ShTQa8>ޫe6m5q*egNgEŬȬƬ  ڬjvtzrS3Ȼ"^utTtB{kfiOln3Nj`QB{}n4qu|XY\jkgx^u[|[}lb Csq;wh@jqdm|tfornsjynbpO&xpsΐ0&_j(0w]Ym^zqjxpz:~`zjmi{?k@ @.=.5ji f'C0lF?00c=?>Q-.??jjfbf7bwqqluqsb_Zuqmj|/śmhbjdbgm"REbYtmjkin:]?SEr}rtCcHbgbddSh_[lvUSPGQǿصnaBRCKPrܮ̭ ײa 8N=hYdeyhdH %:AaNıdbtA𴵳|lkBXITKvvtpHR=a?eqͯenbj_fibhJuIaIa6z|{i}jeiU0G!$ oUSRcP_s¶ʸoo/.mtHݮ׮ԮծAձұԲ,#FJ`AN!!_? h 9WhMX?BPBVnxoqlekBpoqhmluesokhn GB22?oA229Ajn^qk_dYefe7{4z-j"G>mlcepO@AvEәՓkZv"Z=lhm4:fe; GD@|okgY<Ȭά !g]!FEFssfD`j`iEEEi}j}N g@j eF!!eFB cF!!c|h;ERъjZamQoOqK~nԙЯ`px\sc]cgv`jta+w}b[خ+î̱ƱDZ6A~~{jpccJ&&kk}m}mM>hP1711  1 1e3 h :jj* e4ehe8}yzy\\]o|txqyt!~ĥǫjfGgJ[KpaU\RYYm)y{xyowh{E AT|zxiwww\W_qwq|nut(ѨlfGhHZPp_ScSZZmJs}kw{gwR&+ٷ_ٴb1ٸ^|QcQ?rh]oeihhuΑknwvvi@*^\\tgriyd4qV(""J͞ԛ*·]h#gF^QXNh)t N&6lOTլׯٲS )Ao}|puodf?N? A,urzvjiimPgT]Wpg]ed^_pO}zupjyzx[YWϯi}u~syxQwvwfQUWW^`\X`Xfk՞ږח`yuzyzYZYνϷom%c6wMFgOnԉfC&d?c/X- ̲ޱޯ~7@)iZbze{eK 3%+!z"aWccyf3~zzwwbe  GFf ef" f fwlwHmJnNȦʟi*lhnupo@Z]Rb_QYS_TZov^YX5ۭЬĭگѱ±/͊i@?iwuug Ėxwx˭@mYY;XXF'FXjXACIWAJVDXv̱˿NObEMY̾ϟi8[ ^,ajd(| VY{:r<_DhlmI'(cc<4i''ccc<Nجì쯧ʯ*njR@?Q}uzjix1QS\aE?T`=fi|N:C0z_etgq`wz߫P{#sj/qZ"jstwG=} |nr~q{{g%]!Qy"~wosm{Xd]Mim~̲%δ.Dffvf]\n]k\oOcc#|] +kzz¤?imokWp_o{iww\cb4gdo8dJDmmkKe-txrhzGpnm:ewyrhyn5hyZr[l`fOzvqgedgge{xul{2iw\u]ka}e0{۱ٯ߯%+%~teTge]5H?EAthKLJKje{xxqqp8qxhPNN<NN4KLopo_NZxibff\QNQTDbqһXQ330g`~ebdʈaW99`XVž7W1166|zVTTWB00WB//VB--CC5IGElцт|**iv5|?o=}exgvhJ9ڍԚԚC}A?i2T<=;gy&<75l߉܃zůͮǮ᮪BYVdk";kd$KjK=]\]\|QrmknuutoYob<]?MHbFvsp^[[!^h }h78<­aj[fj1a+p)tgbkoF|iv3lUJJ-JJ0JJ/VYnabXtV\^~%Uuѭ֭߮έ+&#G1,H rhGuvw3i0I'i%@UO%%ca-, c U0259̕ʛƠwIrE|B i}H93N5XteplLh9i}KMb_E[WۀLolorbb ֮Ԯ®鱏ֳ^ehgAbhhT"猌>=%1DW~oHUZRahmjKfGnFpoЦժ˱j\<cib?`hpX[\}[?@ijhldvZh^Zhgggbqgloco o> endobj 58 0 obj << /Filter /FlateDecode /Length 295 >> stream HU;N@}YD| %#h(#NQHeEc!d;3o潱 Nx`Q`{󲇏xu.KAR$9warE*nkYz4L%Ɏ1f'P6.i@`U3*J,֖23_޲u~HFק٢=!)[-9vxY党Jl0bG([qG Zĥwѽxȹ$=cƌ?G endstream endobj 59 0 obj << /Subtype /CIDFontType0C /Length 47329 >> stream FIFHOC+MHei-Bold, _fxI "]A0 %Z $ HYhuAdobeCNS1(c) Copyright 1996 China Type Design Ltd. All Rights Reserved.Monotype Hei-BoldMHei-Bold-RomanMHei-BoldSuppdfjSWZ[dgjw{} !,.9IJ\_fjmtu &*1;(+678IN_at!*,kp58t|"+,0H $ 5    7 Y m p { K ]   w  n o &-68P 0@gkHc2Gp-/Ga3}Lfn5X5Y5^5q5r5555555555)/F^ b<t)j:1q  S o b zO uwiTCjhfYv59 r!""#$F$%&'n(:()*+z,;--.^/X/012o34u5/567<8)89:;6<<=>?@ABCDEF.G GHICIJKLM]N=O1PoQ=QSToUVwW{XnYZa[p\S]@^@_I`oaqb\c}def2g/hijk(klmooq qsLtCuuvwxyz{|z}~Q=wێkƒ; kWCo&_&iA/cVm*,GGRGJJ  7{Z/OٚȬÃ@!#4ns4= KJػ"x|KsEqCGZ&~(wGaQ[P@P.z|ƧUnW$>;>Č:Č[jj%CQ Y#[WIMUWQaEaPUHZM+d :\;=aa>7f, PO;f<݌=7B׊Cꌊ>ofDޔm?GH}T7)urBaa?PȌ=@YKiR$Mm%Fq(%nr>)chҌ܉mwl-5C>QuCԌAg^V:B;X'Ar~up'yx,ew~Rz^x`~~rqx}hKيL8Axd;dP`ˁwDJiiK)?|qlfqg,6"DJ^'&ȿ0$ VVv эĮfSFv}woxhRG@\@G@>Ggj*.;aCva44BWRj*6BF`%Ee;H%S3%xEc%k?WNUCw7hH˜ǘw>nG?D?y(D/?ETB >;zEn ywsFQEa_FB֭cS?P( P\,$Ҳ]$"FX%:OP3%J(f)׌?I >_M=4PKJfO2Aj\h] v~6t >x!L\6!Bii`׮i=&Sg1,W  $? MY(/AQA<gEDbFS?0{<~NfiT[J4tД/S=I@Zj)9ʻïʮǞДZʷ?J?@0Dy6x.U<:=y|}ɲ˫Ш˞# 13XKHir3G'MMDlhjihvW-۪ J:Si;?)y*Y6R*&@ VIIYQM@wysuhJTtWaKAX(hAt;??AoCZD`jY_.AJ>MxWA\CCT-*s.myrVWL2{r( rڊ,ۊArs_l1/WW~jwp ĨbC 6D 0/@1vW6>hX>+Bel^G7XbZ_v\\Qmvp榀!Вג5A#A}0{)k&g=9#g>tF/#~>,mKЎGIBLEGېϕOAECbmk}D=mH7֔Fy,$sF=D;V=l:oXc5>_Fs|yu|4ɞ!(j3n;q:bvuzsLuJfYf;вaR;IagqtKAK?tAWSHWWC[ P90L\oK ,JGخ@SEP?!bvcsa[ڌ>`ok|wn|u ڌ,?7y5~~{ova: C= h?9Yha[|pznQ)+GצEd=F- [|j+U?U)k? /?Rgg~6=>H~u?uRߊV<ڌKJq tboKĔЊ?\]Qkto-RٌcAٌTU+rbqbL )r0? E:%** ݆k?5~~wekY79?%-. |݌>܌7@-A[J"V6J]= ha*y/ Jy\s==3; dG|/gaCn]ZOPibkE$0HQhJcq=R+%й%OW_PgcTSWvilAa|x2>Ǡ>S،Woo_Ga@ *nZ@ZTUM W# +_D0=0?W7 +:!O*iٺ³ެNډT6.D!@6n}{+)9)A*AG$$8M`~.%bknbQ>~8mGuZmbbY[ݙonjmhb=/A%k%kn.k.klnl$k%nk.k._RF݊=݌K׊\9\ԌS*QP؉PO`_ٌ_`.$b%&4&S$&$%a%&:.%.&IR$jAA;|dcWhun[Qo)0SaT KS<#ɿBA)PW "Bh_RGKWsVR OE,Ei(Cע]N07G&׵QiG#'1֧֭FdIB3_`K$jOc:QyDx&]ps_`U7Cyl{̽Y- y:?y-ycxv|E[+A\ Js. ֌F"286"ZOXJ8I;fu_^DTwsn[k'oGΖƝ  SW \ .c;M;M;;.:dO,AJs$Ok&K(Y*~|1f% (D> FyX֊+ጊ!!D&3AH,̬f_ ?-*mjʉARCbmAuGiBOy[y`AaW*(QЊlm;?:YAXvp5wQf"R0:Xʱӫb@6ō26P6a tҭqh (edZjxrY>~VZ|eBf^( IV9 .1}/.GiR-kru{tPM@XPn=_]8 ES4$Y67;O*k<B9 tC1t/>܌=b_ug>/9/?/B0&9׌zBJImkxQzZw^~~w#ߌeҌE?7:T$Q_ȡKKlJ&wij`am7GJlJSC<qPH":1"BSCABYðaΧN9 'Cꊦ6FA.}`_XiU[4hݫrzpWIIA+2HUY?b8H֌ڊ>ٌjVhvb<Д@mP;(fָװԙ銊؊5ܠGV??0c¥w$L'II{R~Xxb?B!c0U3$=a֡Ii7W&5cs+dh׊i`u:kzo]@#¡5T`,<~pvi@hhȔӝ|y,Z(|I@ܔtBlU1 *v|!*`F6[N6px?LԾѢoPo|jp^lwsf\N?NCv]{W|J|pzu|HΎP#d`'wkAD^~W\eQpO|o[ G>BALALaDViD15ZBִϽϰMSR-M`Y]<ʎӊ3GSTLx|{yxwhZQ&eQV`CMTW1JaK&3 `wB~w>YqGsxnlxzs^n)|$#&lM#(p>fK98w)N lVT*1}~wbeT8&xvv[PhQhhvrxqvavhppHU~>THW(^'b6i1p&oIEIfpfP}XjFNVI`^Y[RCQ\lVGAAѺQ&e oU>Ob-) ҲXuJJA_GJѾѶҷEg/fstb`VmurÎ̂˱Њ銊0 ъ\$#;< E!_ZaɉGʊY'G'QECbMbfPeWOoSPL\X>n @"nV>YNW<nKpL<Z08= ]׌ѱD&JR-H8/FSH7+d[VqljK^N|I(ؼL֥֛tyowk)b+pM`PWLet{}jt]ltq;e Ayor~f 1$b٦W.|[`h]Qphib4683EQ;z}p\UɺrBϚlicb`[Dhqs{/dG?K\6%BwNCs|ttoBUZ`KSRI׬ͳƼI{$+x?Ĩ2^TZhnr]bQ?֖ђkc7MZ/Jfgy?kXMUXxSƩUVqgTȺjBSR[կӝ*XFECoi^FE@ZZ[YYY)X X`6B8oYaS%ESοĬ®\Cc0aR4>CCxN Rx~F:kÊBF`%Yp!tE! Klw +͹θB%p;؊36D<v3_BTOåjfSAij[YMqhWJTJeb9snc-TlBCth^CqZaOҦ\ٴG! !, |={fLPQ5[GU=\МŌZ[BDZC[:oCqXhkvVh׽ۭ ZJCJvCvKKYVV[?[8@`'U&jɜݐ?IHU#B9|xwfKNL@PYٱɡ~vofio"5.|B*m.bHsqn~A(ر7ohrU [썣mPTGd<Ɍ̊(݉C O;d֌=JP}Vv:P@:Ztwwͧ͜rwE3yvia@MNkmRSI`b`bA~iNANW'I.+C[N1!؍kPE0% Dvy9O)>Hh^iAm7SHX 01CPT7V6iPþ[Me+3R>:(q~iza͝ŕ'>S[auuA8(9(8m6oS[Sac~]Zh>82YPP9&wSY&% !NZ`R͑EG3UeQ|tklh©ɜ RYBY`B`IHRffi?i'?/}7o\phPlf@0FСI0kIc>ne4Oؼ_d銊>OOKn@v$WHGR9TXǹfolpnřBYkXmo @y(a)`IhCS[DUTthh5ŋ<#,h-h>lGDՔ>+ gI P5SX ,j'_i 3&^ xyQ-V+j7{`;+=+I ! %$F\Sr/fHz$C$=C6PBO/||it\nwpɌZ\%% B;Go￰űTkVm_cfΊqup=>FBMſĮB8a\_u%@&6DMJ>Y!$NK% p#7U F-0-DGO:^%lOU[h$KHٿ M>%jxao^s̠ѓz=ooB>!=!@WXc_XnyYomaktt`|il}RV;U B p_{]uN|pyxd1VFq*GJ !c1^iWUNad[^p@ D$f-8"NfLҤѳD"D#aM.1 Z &FQ! &݌SO{Q|RppakW9))C(G(7(QZd @6BGV>+ HaG./$Z3VgZI[wCIddedHvCZIZcӝwl7AIYϽڞB=CNCyD_MMIVikR`WGYYm[HWb]SBXXp\HžU2o7B$NF_F=E{`@2Naqkv_˸=cb8?8cCb>Bqm!V6KRWFc5lG5{GuZfNig|4WPKѥwb\z cp_mgyPٲਅ[:iW$-8SŴR[\R]Xqsz;B>A9CIC"ViGӞӱByvs~TE!-Hc>C, ]ʪݙPCk ie{YlididU\^ht]dKw?wDܤիƽZiBw#>ǒm n{@ C8""'A""z8 DSku! 1/UѢژFPaZ:B`R 80.`Q ؊'8V=] S*vEEzTͼJW)2>,SsyuΛϏTa9^2\LݗoI?B>eVO[dBa2g|pwt޿Nhv);B}÷ˬҌyktͮsupspfGczwxrЬsysm\leih6~k_[XanhgzfvwtY*J-*PXm*jʭJO()''UVK]uإJ˜[xcypN  [>[Dh]yT|Nwq{vnd^@“('?>Dwih^jwsu>!UDVzCQQ!NnQSHYToY`֭`KYW]Q 530N ] Fcz3;zx|fwrwlcop~|zxBazZ{PyJbzona= ZyaxpfX?Wl5gGJAY{zpʽѧl`VK]uoqBb`&0F@lHT.}voθ`WKSUveKfdOCQTrYEɺo6?6C6?-𓵏C\H|zOJnrU)@Dh<JZ3xZ%3ZFCS6@/V/@CvK.> `ubSIUUnZH)ޕ> :xŧƹ_^W[Y^yƊ֌ÜȡʯXRsbzb|U\S^P_SEXSpXKǾ( &D~'d.eL(e%5An}gk As}msl]>ߏ9?*DGOYWyuEwg>4ԕ/rډD܉A[45}))p?>Q߿直JnSWʵj]S}S?U1B'kS;* ]Kq8^ B>Dr Á[{2E@GqX[_fgSQ^>Ob fDHb ZH tm`kaq}hyWgfץ@FB0Ef̽ɷR%s=A;dnufxu{ԪΫժNrUxdxR^Q$aF]$ՍvFkBh:][Qkhqxswda8dEgt4tBs}m{qyj3F43!G444484If*I#l|?! `JzjJRM ~9’wre֨xfP@oxrxe\e@A_wC_GBB&GB|/AV(E&.7,+ojrAdqpksc 5F^t I!\<GYEwC핑@BA. LbL$ֿVAzGR Az&Fūϳ6/68jG8%TO#QգשK&Qي&'B,')#+-? *##lKT O$УНFHJ^x]Mv{z~ry`{rNJ%7 o殥QSHMTHuxdgLC5Wh9qI޴~ =f/uJ4ӗxyv8[NpFS Vad~}|VYJ2~Ç{л _x,EVP_-J*(ZVB,]shcHj2g^>6]E;ϮBsneŦFw4aLNIVJ=ͶVrh_Gu:aOONQG8Ͳ/ST<"JXF+zCx,B?Mw2q?*Ck1cXGP[hQEʹ<H7kMWIk?m`HiOG;ѯK?GCEz7'/LWͩ%|aUǸ\YKpy=_NCǼeYCL_4JSݞBB?RSSddLM ; HDHkEs!":3֊D~hj^mvpBvLG˿tPGLXLԻԘ#԰ޚd׳G)e:1e@dZBt7P*fʞЊ^FAMhy~}hj[>n@1CbED?9B:^Bi`[XIWZp`Sż HTY֌P 8dd7fe0d3e3f3e& Z<}Ty}jua<xݓB3v +UQmcSDew{*GMX3Vs|tsuzY޴ذծyrЮ[dyv׊ً̌d-~kn_>YdOcCeNdZ8a[fiz{}|vUH5A}RCB\خմӳӷ ڸռ ]}]~CSji GmŠ{sl>ksrCiw^ڌیy|~ko_>r:D(clmDD3O3@BFL2F2MEQEL3E3! L8ތ8WM8sz@Fd Ү[C mER@\SJQZvN}zGw?GPu\f]^\OVkЌ]$СϦG^/S XFk3XAxqjqfirxpTXhtbuAu_-"W #{mqa:/qza}MѤ̧ĵQcp,8NӜ܌tvrk#`%)C{|Xjd^h_rPs2bkIlebz{)y# !\~&~r}gi^munȘ+D;f}w/A$v$?$wChԻӿӷԣ%פy?y,C]r>L1c{UU@?poʓϘף]f~FߌÒǍiB_BB[ZBYJ=4+@]|wya+=_wgora:Gr+-W+WV'BR,RQ)zuӸغՠ/LH]ڊ ""3s]_k~ǽIuDuTgJ|ԅQiwsmEftrH@/ԊERXDcekf]]e>O_ǯًWZGffH.HʈIJ4ѶѴѰ6vץ}}scQpñB9Fe\~lytgHcyw^wx_u`uu/attOx~ubN=p_[TowsffAaE_fXxu`L]A ӼKLh?HȩƔ0/A`s+ |A)L? 0 > PA-BB7.DSI'@1،c>M+kj_<V;<JʲϣӺ*=}|vqnc?Ę5 ?\B[DRC~[== Q=>X@B5kGڕssEv*c;vK.",Sz^[PS|z+.p&F$]So,s.Iأشh~,/cLhUJMԺ_ZRYX ^NVX#H:'HWKA%{Qa"' B^=BL3B2*xzwfv[=ZvgRSOD[ZIYғZ+/rnlfcqbNbWXw`zjxwA5S<RDeqCgLrr~v|jq^9#Gfs;/.?)PYmcldZzUtrytۼ>W&fEh&CԸԶԲԷӸӺӌ(i?E?FƊC\fX:Q__ _ __B_R\7Y׊ZRZY_[BZ]Z6@RǮѵQpx,=QŢIe"G 2L]asmHdBm)xvA$i]vq^cfy}=۞HXjk% 4]ct*F^^>*[Af><<.WKŸ?V`E֎+WQE\St]Pſ l֊$8׊fЌ7{~/oxr9\eJ TխҚ#E$BMsFMZVFYVpUV 6Z GOUA@BUj;3) OO֊Nt]<)kHuouP~jp|x}afX=ƎΒmLD?\t}@;ix?08lh\αzrDp)P::BeR?ooxn:zs1Dv/WGFDcn^iԭU38}hp} ?0zqmʺCI8x{w~vt|+"/(P\h_r`t,,W˩˽z<B\%YroxtCqe o> 폊PssQttTrruTtLG,(~u}{}nhL1M&r ~oyvX Խԟ׷6/JػU\l$7F -#n 67ei&|o}dkKGCYYnkXst_\% MXsNrBC&rOjLdjCDאє̻˰Աz#P**>MDD[DJDVDEDgD7SE!nSiBT<(6I\KV1P)j+@SJmƬGa{Ph~y'R%o?[tЭ 65E66:|qk_D]^̣ЬE3o}YpR}lhaRPy}iiFE55~g66EfF56} E3348Säɚ֏֧Ԋ~E/sO^BROL} ]*)=UNuF du[^GfZNRϱ ӣC8sDF>V`H)x6,7TL^j(S__H,&ǚՖ ܥUh(.CV|~,<lxw}zSAׁGFH8(S9»ǤYXeYmSKNZgMC͹ v]O?NSoFEɻ:D^>D^=kKٮW0n2JoF?-p-nymqrXC`Gyhb@bJp3j)_*]cSaLliom\Y7D <լʵCIE{=gTeT7ɟsl[Dn^QVUӳԻѺլt86((d"B"'\(' [((pQҌxjfC\~{ϊC9irsjC]hq]zugr rnk}O׍׽ף׭ o835LYWHM}~8AƆCD@8)?7B5BBOfOOfCMfLY=*5*:}:a;Gc0ϟР3(пӰδͱf+N| b'D匊#CW[[[ZUZ[Q_KFK[x4׊jH!!jDHNUdcVeNfOWhoET^ɟDfp_n_lz{,!I!KͲ϶̱ϴQ׋nmp¹91$JX$)VJ'A,d߭wCd&abyrdpOoRS@cHnn@}ythj:?TrӿԳԽһL雵mIIV[DYpR ]X$d?eBz"N(Z' 0SW JBwT|~y{eqY<{匌B`H5L.a[¥L=)XeU $ӯԺ Wڭx`Y^g:brcpom{{~kQo=˒Џۻk;9sUr]ll..;jZmhT]!kO,.poxqn[gdleDqhbGdml{|DBDӌ@)lWneZd_VB(B\chXʵkaVSdZAҎҙ=M%bD 1D: <@LA 4MMAM%NDNNl3MM,B &xooe>ÀgjQ_E^@]$$a2%1%S!S]?Sw{zϷUmLTXXlU[KԟMѠ̐|ČC0r#1 kΦ͛;haxY~|H1B!6^]?4YBZ{Э3SR%v$@\2c#w 1W^qCkN[CVvx3G,d[VȴdsKS`YþǫRjAXSIT[qM9f^ڏBSedsFuksL)b-,?:>B#,B0nPOS?fFx=VV>7cW?x1wW"::Dkiv- bcRNQXyv:ÿbrdDU]Tt]RĽJB( Q?'('62((U((J?v~z$6 yWX`TPXYn?8`RLZXk`OýHu[@hlkAYGEXZĵҲLXnaTJaRS<вY-)jA.!B,-*?T&B,$HQT+-->v-**))+A.../))w0,挊-ʨPlGODHP^]Z@@dUENfi0plZrynOINץ/QRDtpUFr~ %Uh\ia_kzv|un`umdkvzsKlAcΑB|]lXabf_oXXlniX`Mf?jǑk4UW=HYRGOnsfqCJrZqggm7xsc=9.M6#v>Un˴BqmPSr{wf`M\sql\nSoFtG);G\}tn\nw}zZ^R8ҔڔiEQPoyxt|v`Xe[Sz~|ZaEm:rKֳýndUXV[“6mm,wyrz>M^PhTg\jv{|OsZedq|uh|Gn;ZIH/͒cځFwwDFP0G\IJoa_ԭr_^ӯ{{F4`LLOjFADAD"ӊ,FF<JD~~ih\<2ԃeMG=2aNKКʍӮưįԩҪԹԋBbdgJkS()4L1\p FcK_[f\[g\-[h\T>USmDHee]~b\aŐӽʻɺԱב&%yo{pJB7'&7%6&7""3ڊ3B,Wk E+ɹe}ZDDCC\CCAYCDyt aQ8~jVqJѣ+~=At!U.e5տVw8898Zzv[]Kggh[1t0,,,*8*-~%++^ULlVZP_lm3=PƙӐ ѩՊE8oOaJCKJ"tP"1JUǷOxLnҩ˦̰ḛ̢̂͡ƬEefD.ئpԊKm+Ileflef4fff?gde@'EEiPgEETIŒARsBvzqwq9PB"I?8VD10.JTwt? (=QT> (PSSC;4}xz}sn^TG\8^+yIٸ^m)ӷʮδpמS|jlst[ƽdiq?F//g/L/_/hB׌|3͌xnfA[|wC7dnvl{ltlvjkn]XIOXp]L@Xdaqog٠De`nU}'XKNn?wG֧αXӾӸԳӲԽ ʍMSGE#C-"eppumjt{C~v{/Gwf[o~b?mK6z?WF͠ז؊'c2¸^dXþx>Q:g%~E\> 51!SOu?Hӽջӻ԰R N_3\.MeIJ>[[VYefOfOBK13,[?ZBRew[vVqS۷y{||6mxp`{juw2yfV99,^R&l#`'\,W+l/s4Y,q]=llCikqz8E܉TpmTi$BXB5A/\E77+]u{u޶ŷwgXþdTVzw34UēQwQt\jabvq\gҺҵӯѵᚢ-oiƧɳbک]#0Ovpd(7}wyov}#F 3@@Gswuhh^AubwqqqI.5XMpcvn tXZY`YX4XY\EӻѹِؔiFٌ ])n@MOQai owzÌO>P/O>OCgerst}oD덍\EZ B7K/]pJ&"B|qmhjpu_u-mc_[Vha³QYhf^ŵkWaT`tYŚN..A<ŌHXX"XYJXYMYYI@0%PTf^ɽ`MKVXh]Lɿ%AcļŰKgN]QN`\%`PDQZkZGȹzcSJS[a]K˷8&@\8oKQ Dtd6(Yz;6ҳڽ\2Ez:R\BM:B4yz}b_nNvbzbxkcaqηٰIe(M;3LgPSFCMIѡɒ\|dcKn!xcggLeI^MRRaS,ƺsvIy[bSϠDzmDV@S]UG@pmdI<gB^VPMLCNdzkofLIHAה̅rB67sEcC{ҠُD[YѢѨҿӸגq-j(C-s`CaPE=.HRUif^Fˋ9JT[Vc`kWs6r<{Hޞ֣Ψ]`}GWXqhra[\hhr[p}y.U[R_O|{oJ@]kmOđɕa@itytlZjehh3pj\LarizrD^DXD,pЮͭʰ̭ͪϢbؒڒjmiiIhE"Ċ򢀥}kpxaa@?WOzPJ :,cOHg|t}vWmopcXPbcsb6D&9bEOD1[^WwxгPB) J^r\uRuLٸF:½ ը՚&FbE  ^SSbfi`IC""dbHurd}{vLc|BBf¤Ep@eIX\A\ AAAo@p؊}BՊRB֊Gϵ̺˱fiGnR21+ *ܘר;rv+?Eђ|}qjjQk@W;=`^r3 YKM&YuCaGdR<}GG]FFdGCG`F[|[dVVL\RN JBJ^7rLװX ʴPlD^WI[;"23B'MBMU$$PZCZNMTT"F_&FDъkӊFDk!GDkHE'=a`gQBKdredHc`ZGOeXFPɳA/:`տۜТE}={ShLpyEx+7DTE:T2]O̻ùMJjsѱШЛӗ}י͜ԩҗZOGUE"~nb^F&>)`NO#>(d\D D i]ZRo``PdKyAIVT51ޣȠԑ}F)oWW:QSH$}"N$.;Y6аȯǪв֪aؽt_6_lW{uEPEdKsumNQ)L ]oE߫үk[p?`O`aOa|{irRp `=`as¢ѬɌF9htOmLz][S^MEԼkD 4RtBfsr{r"D"F8 ֌l{gq`tɨ͒UƮC}tg]bdxrkXVq\_oB7x|3?}USBH5VP=NICr1yI٘Zϙͺʩˤ ˟˻Eaum~wfEcKxgyenOm+Mnpvmnedi|lh`I   v!!k&rk!!skvW,y*}MP֌i&%ԴH O@}*l/r_}y"q=·hVH{~}~xvmaJψӌA9M>[[=:VCWI~D'w(G3.6__ɴ^]cvwoS_ehtz @  rimiip7##""?2xh>skpw g  U aYO  TӠk F=|zkCsig^\GVGBP֌OC}}pka8ԊCZ#;Z;  Z-9Њ 9 '' W[tnD}G0{2988dʵț#SvcW˻ppZ|'];]'xFBnȧŐGFuTbSmwub@nccOԪW7 ̤ϱϛ]"wkFunbYn Ehswd_rGq D.;9Ja@TQHUEԞӓ˓~rɟ/y}| BdYplmm&B)Xm6~M zriP/BCnVf\UxmWQii_T(Bt>ˁjH{XUKϛ>ϢӊJDQX1x$ɊrFNFyJӒL4.bœxYVeNTlEDvc}\rk~OaD IѢC-T%7*gءģpst|{t`Su{y~z~}{t{vzytyx|xuiqj{|ilϫtIo;m9P&^Bz}gf9DZڥo0-LWCP[zomaCwɽU^JJSC\PCY]5YEDUXE˶Ͱ̱˪Ͱ?o6kGHf;RӌQ;AJN..e/9$把O2<N/  7Af e`UAfB@"! U4ǧ͚IkQa&@reIZ~xHىiL=S<3S<zzB"[XRW\mkWAѹɲɭʺϰB,v!8LJOI@II'CGIiH7Am]^E-}vklbcχSm:|,Fs|k^en `p7HQXɰ̱HPX@SjSGgNf,\N\Pdc tzvmlu0Q~>emބ{␠О ׹Ĝ;ְGWyHhsxY~sVNO@`[ӶҞMZ)/׊Ac)C iRREDe^ܭ׉N`T|\AHG?)pjo}cWldkZnPpc^XTZ6^]P\TsaW C|T+?*`Fʰɡȷ̣ɬ-԰׵.2>>//_ӷ/_.Y_-`- 4mQ }^42-"_#awF k0:.nnkm nim?mfm+U/@R J iM˓ʸʴ ԣ&%>E[[]ZZVb[\A"-Jh?-oKie)c%d#y 25COd&Fťǒ*b+d)x!1?a} [(S"nFkթΞѮѹfҢԧxzDpnt#nrQ`rxt^!gnEdR(CMET+Rg~r{ptp.|w{Xf3YfSSеcZZMdw5BLɖ׏䟼wB!qV`8ZSJud<+EOPs-CQWҌԭԦ Ԕ֕ԥԮpWvS`kimNjuaٌ,^n{_k_~}qD;y1DΓƠlabpxC [[hm_EbCTvxrwjrxnhnropxnxQx?[k[wgWW"WWjd˪˲ɨˤ7Ӥשg][ª%%\}ofC`||arKnMdLl[bqykXʷGpD^DC(E ܾF~c_nRz?fuxWLETWohM˽Q E>.zX}K۠կV4ԺӐӱԸ,םǩə.a\ZWgJw|:B7`C."C0B$BMyLz@y'/ д,-fmBBBt$[,C,YrG%DYNp^@K( xܒ.OwrƌɷdDZJm R5V@D_}\|M}I^ơ]~GIychSssZHHH7^U|6H}[Fc}`yNDg7>S(2FmXЭ~{ji_='~*tl]= t<KHRƣagdNaLvP(baUOWvmO&{{dIpUWFѥxөԲӔэxuu4E"<,ErsFۊ!:2~dhaketrxzpf@f^ƛX˫½[cbs/,LFJ&DF/dbjM 9DZykZ¾[MVE-Y=2_U˭rudcjK~'E@.aW6#[3@&A B=TT@^:dnw֊N׌}׌ PW5#*ɧMrmqhC+ 5 5 3 0D?5ጊxctetnz~y }xjJkdfj Hq9X(_ Yw<ввѰ"Ҵ@"9@xA|QnW`TX$5torω\krhiŸi]`O<4yxiMgzV2sngEbwydfkd:_jcx5BmxTÓ˞Fy.h$Z.EI<l2bOXTġUblJȶjB[Yb3h_R\Oi[ĩZwηѻѼѣ׽6і־w{do}PQ}{zxֻg+LDN]^xBCf9H"D*>͛ʩȂl]gY{{{_VsiZ]bǍCHhxY|KGZ(GS$RZxgefg}LTxehak NYvhibo{QWxgfeaMرֹҚ;sq;T~|xte>b.us{P_iXE\kmoBS|v{o}wlmH^rsqkm^okzwՌ[U٬Q[JS\@q@`""] ""Z'[VjV¢ V }qwmwxwy[ACS]cSBŹ %  ?ִԩ[FFzGUƊxȮQ̒BYXc9 ?O%{K;_1R=  -"-lg~pNnha^V^qtsʜʔĔ}sqoMvw~nd|ܿE~dxnypmruЫGe6YCGGA>~noIur~mb}ƺGzh|m|q+ǫJmBL0JQCtmc_[bC͖ǖđ{oѠe;R6O?5!?&NͭΩ̗Դԣ whItt@5:|"I._ݡ׷*)팊*~wf~32wdytjxQfN=7{4xv|npd>| /m+i  c[yx.MyFdSjg_5F䗌unm̉tBәԝeh`oiʾK_jWjbsnkvVoetujn~Cv8T6æ֑C7hz`wntnck$mv`Ledgj$C߉srpqhcbgmDoqewfntQr đŗ Lsl~ug7gblQv>wJff7usL[jy rQtYxn]݋''Ǡvm1mm`%F:fXu?ZNJlԊհϨ[5˫~saR& :˝~zbY\tcey{k~KFl#ªdZ`wjh|~o{KNjw"`+V|bk_|N%Ǡv`w$GvyH $$R~|u|~kL v(Rkwaw_qY.WȴgFyhJA(2%><%' XD);;Bq_jH0O9/$)- <;'/ -ĿiZvhXf`+OƠ T:MeZM2!6/ ƹqFryliw]vQBeƒ~ @ 4wZ\j{uqp2U XvZNw|txpa˅yqOGJYt[a4 vwnwb@nZTdf,3vvZqp̑˨g:Υi.}sVLFYoLavY?ITmUi=X!`cf1Nֺ 4,(Z]~scB^h?? R@+,Q [7#?662~}|ju>09Áccp|903 &  & ~$% ! gb !# "EG | ͑ Г | endstream endobj 60 0 obj << /Type /FontDescriptor /Ascent 746 /CapHeight 746 /Descent -183 /Flags 32 /FontBBox [ -166 -225 1000 951 ] /FontName /Helvetica /ItalicAngle 0 /StemV 88 /XHeight 558 /FontFile3 61 0 R >> endobj 61 0 obj << /Length 26954 /Subtype /Type1C >> stream  Helvetica7qrsss :u|K riY&2>CIP\biu{ #)3:AGMQW^fnu '-4@FR\gt}]fradicalEcaronNcommaaccentrcommaaccentGcommaaccentkcommaaccentDeltaecaronlozengeKcommaaccentcacuteEmacronRcommaaccentRcaronDcroatzacutenacuteLcommaaccentdcroatTcaronUmacronemacronlcommaaccenttcommaaccentohungarumlautabreveuhungarumlautuogoneklcaronSacuteUogonekEogonekLacuteZdotaccentAogonekdcaronIdotaccentamacronIogoneksacuteracuteEuroCcaronimacronscedillaScedillaomacrongcommaaccentiogonekOmacronncommaaccentaogoneklacuteEdotaccentrcarontcaronscommaaccentCacuteedotaccentumacronAbreveZacuteNacuteUhungarumlautnotequaluringTcommaaccentUringlessequalRacuteeogonekgreaterequalLcaronScommaaccentzdotaccentpartialdiffOhungarumlautsummationImacronccaronncaronNcaronAmacronGbreveDcarongbreve003.000Copyright (c) 1985, 1987, 1989, 1990, 1997, 1998 Adobe Systems Incorporated. All Rights Reserved.Helvetica is a trademark of Linotype-Hell AG and/or its subsidiaries.HelveticaU;-MFZ{>]s d`+Pq G  / G $ a ;  9<VvZae-C"|u^u1Wr@_x7 AcBxW  c y !!Y!!!!"2""#Z#$ $$$%~&&&&'4''([(()I)))*<*+B++,t,---.J../h/0x00111i1112223Z34!45I55646}677C78u99:_;(;<<<=Z===> >>?Q?@@AAlABBoBC4CqCCD.DEEfEFF2FFGGHHeHHIIIJ JkJJK]L LgLMMMNJNsNO OOP;PPQ?QRR3RSSTuTU#U{V,VSVVW(WX XjXYYWYYZ9ZZ[b[\ \\\]]^[^_ _D__`M`a0ab%+++wO*%s?*ccB"Bvf"fwf$"$fHnffHnf$Lx"$Lnffnf3x""xA -OPȵz~aSJ`N2_g5L\K 34hs'p3AW+>8z]U`Nvѡ\ѓw]]+@>.->A,¸`ST`]QV\$+@>.->A,¸`ST`]QV\gTfy|cv55!WeUoKc2عؼp_ը|KNWfeq{Ϝ͏8V|{_0׾[O>8MjK@nV)TG´üt9ciOW\ܞ#Nv@wq.N"DO0;1R94Nv@w?c."DOG#0P19X+64bw8iH/i-Hw"eO"&vlmBmlllllB+\Ya]ߛ#|1+S#!+vwzuIx=D]!&&]DD!D&dk^^dk&&k^^k&vwSFo\E8:WDS/Un@`.U-TI=&uԳ)?;tyxvAHt :LT1{͈0::by~GZG챗:Ma$Fa3IpG|{|v?\w?$\BR5??1vx)8EV ׇT&3RB0tKo̹KPθM`KZZ?xIѩJuX:+Ca҆3G 9uht(= 4P7E;2v]+S#!#!+\Ya]ߛ##!&x|66|cE|c&BB&x|366;|c|c,$CaR}}IGECrn楢̥'VW|lcBSKG*%x'O7,;K 6Yi䷱`Zqb[/!4Bặ`w*IJ3Mb?;ei<;j HER._.CEE#F+)4 AG{3 GyvewqeebbeyqL?DeH3Ro.C*238\ڰͺFSw&;XX&cx6 }+Me-q4!7p-;jmLFO=Qt d5c"O8I0II9(PypEp>bAvpKp$bx`vet>{KLYaVQgS[*&Pq5v)~!YC?#g^ϼ|.vw 9 *b b*+vbwPb*bMx"ws{DH;<*ErU1HbyvbwA@*b wAb*ba(1vw\b`ab<l^^H0v< vw\bl؍b-x=-00-==00=/9s9s//ss/yvKYn0*Pk4U8v0;bxJv28(Q|mgc0-==00=/oE.aa`hAv   xwbZ0'b24,0X*sUY'fy6vbwpabbvw$Xhk8Qb 5!5"Obyvbw  JJ [U yvbwAbbAANN5+L:+X"O*O+vwzxxI+XDO*ODlۋw}`wh<Ci<??@Ycj)w̾=Vǿ:xtN>)|G)#޳mTWrv%y&y~%_1Nxccy,a8ZKE;V9InИ|cv_Hw|!̍nXF;'<NWreT3|b^4+S4|HM|"qWA=6+'- ޔ6;|X_P uղaE|cv_Hwb3vc,<';FǛұ|C Β64fS+^|@098dZK8&XMA +A=6+'߭ͷՎ @:+vVV3}~~5Yg<1CBVVp"KΒ64fS+^8>ub,<';FѹnK&v:{3 zPv_Hw)%:7_Wjr3bյߟ]Dcvw/33'cfTvnw/3P~Wyx?3'Mvwkw\Wuq46bZ7cvbw/b3b(v_|wpp"㫽̜V_Ѽ֡ZC'!S:hgZ_|m--^Nox8v_|w)%:1ZNox8"㫽]0}$!;;!?!;;?!ѥEEqqNvT"K"H^4+S47PfjF;'<,cPmv8NvT"K8Avc,<';Fѹ7P4fS+^Β6vP|ww9׿ȍI]bNh8M|%S ~O$,WCfyrx}aQRrLʹ6L c e3GpؔTj+V7&3&DBLZ┤lyh|Nbwx}3?j)R_3 f߸Ȱx?M?vwxp>%S[+0v) wKXh)),3!/%/)&/'/++MvvwsE L LCLYYMjYvmwr>'Va~]syp;h???*M J`W)BFJXӔ~蹮T@?9\_h=Mw蟐ɰ>HXX\9@BhU]=u|||X]h@XXHJf^>)fwMj#=_eh_J?֮¹&Lщlvb0{htrfczhYPediHg_auSzyy|09  9*?ssx[vvcׅwh`m,Q:gdq04~w/0"P;fiT8Ԕ6"sPvNyyXj{RvkSL{{lrhy8#FF^b||i{p;aKMZ^{vfð;jyO8K+UU 8X]fvfw:SRNfvMw~T6TRTMMUUU/U'CC'U.c\|wfv{b4T:D{oEKwyIIv{}|:_S`@Qk`(#;Z+AdsfQiad6mSgf tuiCGf1ڬ3Tvlʾ[N&^o@k}vl_XlrerQ~ktRSeUVVUyjeR[[Uid{STTUaUS^fyQU{i:`8-+?8++?cw`cBj)wVǿ:xtN>)9Vǿ:xtN>)v11X"1/1a"1/1v1X"1/1v1113:":MvVF@V3}~~5Yg<1CBVV33'MvVځw>V3}~~5Yg<1CBVV3bBCgw|CPPg-gQ?Q_w|KPP_-_Q?QQ?Q^^PP+R jmqfjnll(&| |A  0Q#;^D43FD43FciOW\ܞ#ھiOW\ܞ#9!iOW\ܞ#ھiOW\ܞ#9!iOW\ܞ#v11{13:":313:":3ϋyypo#!#!#!τUvNʓwNʋNʾNp3GE55EF4bWXaaXVc3GE55EF4bWXaaXVc03GE55EF4bWXaaXVcD@]T!fA]1K`*sӵęӤ30qtNPGJqiIGÎˎ*!Y$2!!Yr2!![`:B.(!.(!qʔwfxpcwxPuvvqHn[Pįǒ@Rwol}[;`q||Zh&ɱ hV0%V0%60%гֳ;VddVVddVW/tnnttnntuܲK5xlffxr|rzcշxJ~\!yr2!!2!uWv7r|rxfݸH-q|@kWcյ!r<!!;I.|||B|ϋp]Tee!pbz)\x5hZF'p7Um@yvl3x$OmUfͮotx]`|ҔabYmV w H*+TQa x[KC=-0CQapjy=0p]Dl:2V=9s/9&>81oWhs/uOxKpKvz ,^JYiznUM'-|_ S k3Q v@OpL)xJ7AA7gg߯HbB<<ԴڗBb`|B@0Boew@:dZK8&XoMA +"c]onfj'8Z޳mTWrv%y&y~%_1NϫؾgB߭ͷՎ\E;V9InИ+vwK3cvbwG4Y34YQA}Tvp׋wllKCdUD;?!HGXKCqft;!zgxѥumff`lEq[iu|@?0?o@:dZK8&WoMA +0Ll@Z`E8;?!!;Cn߭ͷՎoѥEEqqA|XvvuR>[KPhU <h"&NZ}||]@#EaAƯ0(*::v]++:SyFlA]&llBE NvUFUwÈ{|j3!gI,RQ3nmk۱Jv&A[b00Os 0TsI0II9(PTc"O:)Pvvv/]+BSR[Nfs:SyFlA]zʠkoTj|WoOjQka\3ͬK9Z}&[mBm55ll5BmyvL8^KYn0*Pk4U*Lv0;v *),*v*v2`I>${7b-{HKbb$"ORNfm:V}yFlA{`&xtlBMfllfgkme+fllfgkme=Pw*B*B/bX\(YVV^YVV^&$L88LL88LNvT"Hw"H^4+S47PfjF;'<,ePoy3),*v Ŗ޼V$vmb-~HKb`MO$ERNfuAv[Zs l^w`V3 l?MЖhvVe}_pXvˊDZeuQ@BʠkoTj|WoOjQka\3ͬK9Z}x}6MxbD4omD4bdD4moD4dGA?GJ?AJxmQT˓X$:HUHYS&llB|Bwww£TTssO\!XpljAg~yv RaɵiXR\Vj);CQ%&v^^X^]^]]^]^X^]]]WX#V.[Zs l^𤒭V3 l?MЖhvVe}_pXˊDZeuQ@x}LxbD4omD4bdD4moD4dGA?GJ?AJKDS]dL0SʹgT}<+8)%yvew!qeebbe2!yvew!qeebbe.(!.(!yvewcqeebbe$0%60%yvew!qeebbe2!yvewqeebbeVddVVddVW/tnnttnntyvewqqeebbexpcwxuvvqHn[Pڥįǒuܲ_շxJ~ڑ>-;jmLFO=Qt }+Me-q*0XFxlffxr|ryp!Ep>b52!yp!Ep>b.(!.(!ypEp>b0%60%yp!Ep>b2!+vbw!Pb*b52!+vbw!Pb*bZ.(!.(!+vbw~~Pb*b70%60%+vbw!Pb*bD2! vwqWbk؍b-O[xpcwxWuvvqHn[P[įǒx!=-00-==00=/9s9s//ss/Y2!x!=-00-==00=/9s9s//ss/.(!.(!x=-00-==00=/9s9s//ss/0%60%x!=-00-==00=/9s9s//ss/A2!xq=-00-==00=/9s9s//ss/yxpcwxuvvqHn[P쥂įǒyx޾!Hڇr*BBj'i os@$ yE/!0HOTnc2>E.aa`h9<!!;I.xw!bZ0'b24,0X*sUY'fg2!xw!bZ0'b24,0X*sUY'f7.(!.(!xwbZ0'b24,0X*sUY'fK0%60%xw!bZ0'b24,0X*sUY'f2!yvbw!AbbA52!yvbwc~~AbbA70%60%A!NN5+L:5<!!;I.|G)!#޳mTWrv%y&y~%_1N|ccy,a8ZKE;V9InИg2!|G)![#޳mTWrv%y&y~%_1Nvccy,a8ZKE;V9InИ!7.(!.(!|G)v#޳mTWrv%y&y~%_1Nuccy,a8ZKE;V9InИ!K0%60%|G)!#޳mTWrv%y&y~%_1N|ccy,a8ZKE;V9InИ2!|G)ԭdz#޳mTWrv%y&y~%_1N~ccy,a8ZKE;V9InИ"}VddVVddVW/tnnttnnt|G)qʔw#޳mTWrv%y&y~%_1Nwccy,a8ZKE;V9InИ[xpcwxuvvqHn[PįǒMuܲ"=/_շxJ~6;|X_P uղaEWA=6# UBxlffxr|r|@0!98dZK8&XMA +A=6+'߭ͷՎ @:C2!|@0![98dZK8&XMA +A=6+'߭ͷՎ @:'.(!.(!|@098dZK8&XMA +A=6+'߭ͷՎ @:J'0%60%|@0!98dZK8&XMA +A=6+'߭ͷՎ @:=2!+vw!K3r2!+vw![K3_B.(!.(!+vwK3'Va~]syx;h???*g2!MjYvmw>'Va~]sy|;h???*EK0%60%M !J`W)BFJ)<!!;I.|;b;?&*Icܲyp!Ep>b5<!!;I. ܳ vw-b؍b-ylgeiז- vP|ww49׿䍄I]bNh84 lgei䝎ז- ܠ`v_<_t>{KLYaVQgS[*&Pq5v)~!YC?#g^ϼ.elgeiז-M vwkw\Wuq46bZ7 lgeiז-zw:%_|@0!98dZK8&XMA +A=6+'߭ͷՎ @:iC<!!;I.˖vRy vbwA@*b lgeiז-M|"!qWA=6+'- ޔ6;|X_P uղaE2!ypEp>bR ܳ2MFPp_ mbb, b܂!@yDulgeiז-!2MFPp_ mbb, b܂!@yDu<!!;I.s 0TsI0II9(PTc"O:M !J`W)BFJ)2!v_|w!)%:1ZNox8"㫽]0Or2! ܳ wAb*baclgeiז-|cv_ڵCΒ64fS+^<X3IICIvc,<';FǛұnCؾAv !  ug<!!;I.xwbZ0'b24,0X*sUY'f5R|@098dZK8&XMA +A=6+'߭ͷՎ @:Rc vbw9/b3b9 lgeiז-+ ܬbV7&3&DBLZ┤lyhb`|tkiȔ-}$!!;;!?!;;?!ѥEEqqkl2!!2!|G)w#޳mTWrv%y&y~%_1N~ccy,a8ZKE;V9InИdl}[;`q||Zh&ɱ|Nbw!|}3?j)R_3 f߸Ȱ|?Jr2!!2!u7cvw)ן7r|rxfݼ3?j)R_3 f߸Ȱ?/m}@oWcյvw/b3b`^eaי-yx޾!Hڇr*BBj'i os@$ yE/!0HOTnc2>E.aa`ht92!u3w27r|rxfġf*Z0'b24,0X*sURjSqWcյypAp2r|rxfEp>b@9n~FmWcյ w!Ab*ba2!ANN5+L:0%yu[vewKo5e-q|>mWcյzr|rxfbbea|cv_څw`^eaי-M3vc,<';FǛұoC Β64fS+^+vbw-Pb*b0%|G)#޳mTWrv%y&y~%_1N|ccy,a8ZKE;V9InИ5R+u[vbwםV7r|rxfݼb*b,f~ImWcյM|%!S ~O$,WCfyrx}aQRrLʹ6L c e3GpؔTj2!vP|ww!9׿̍I]bNh8.r2!x=HlG3-7+7{XrCD[rC65!ͷqz@^A?LeⒷbZx!6 }+Me-q4!7p-;jmLFO=Qt?<!!;I.+vwK3@RMuܲ% ץ>5xlffxr|rzcշxJ~e3GpؔTj~O$,WCfyrx}aQRrLʹ6ODytܲHR6xlffxr|rzcշxJ~ *:E.aa`hڇr*BBj'i os@$ yE/!0HOTqh}$!;;!?!;;?!ѥEEqq:Rp"KD[BzvTF3VΒ64fS+^8Avc,<';FѹnK&v:{3 zPcu[vwlס/3'r|rxfݼ3,o}?nWcյx=-00-==00=/9s9s//ss/UR v_|w)%:1ZNox8"㫽]0 lgeiז-p2fvebrIE;V9InИ&=r|rxfѧy,a8Z޳mTWrv%y&y~%_1Noo}8n~FmWcյcvbw!/b3b52!ypEp>b0%vP|ww!9׿̍I]bNh8rr<!!;I.RV7&3&DBLZ┤lyh`^eaי-M ܤ%|S ~O$,WCfyrx}aQRrLʹ6L c e3GpؔTj2`|tkiȔ-x!6 }+Me-q4!7p-;jmLFO=QtI?2!|@098dZK8&XMA +A=6+'߭ͷՎ @:&'0%|Nbw|}3?j)R_3 f߸Ȱ|?@RyvewS2l}[;`q||Zh&ɱyaebbeA!NN5+L:52! vw!^bn؍b-eg2!xw!bZ0'b24,0X*sUY'fpg2!!2!M>8&1E<3 V-_|Nbwг㪳VddVVddVW/tnnttnnt~,3?j)R_3 f߸Ȱ~?A v \  vz{iȔ-xwгKVddVVddVW/tnnttnnt!Z0'b24,0X*sUY'fm6m>?!2MFPp_ mbb, b܂!@yDu2!u7@0@:dZK8&XMA +A=6+'JaWrWcյzr|rxf̸Ԏ2?>2mRw*Ab*ba*`^eaי-y ܠH %nڇr*BBj'i os@$ yEv/!0HOTnc2>E.aa`hr `|tkiȔ-M a`W)BFJ( 0%eevǹShhC[fhnNmQLXq[gvnkVC8XqsæҔwoTF,V^~zeĮkoLxMpSxcphp~}}eШx!=-00-==00=/9s9s//ss/2!!2!6Fv$gpᏜxAnxsItcxU +vbwPb*bRM|"!qWA=6+'- ޔ6;|X_P uղaEd<!!;I.v_|w!)%:1ZNox8"㫽]0r<!!;I. vw!^bn؍b-g<!!;I.yvewqeebbeRx`vet>{KLYaVQgS[*&Pq5v)~!YC?#g^ϼ~.l}[;`q||Zh&ɱ! d5c"O8I0II9(P<!!;I.p"KwΒ64fS+^8>ub,<';FѹnK&v:{3 zPDl}[;`q||Zh&ɱxbj*xbj* Cy A endstream endobj 62 0 obj << /Type /FontDescriptor /Ascent 746 /CapHeight 746 /Descent -178 /Flags 262176 /FontBBox [ -170 -229 1003 962 ] /FontName /Helvetica-Bold /ItalicAngle 0 /StemV 140 /XHeight 558 /FontFile3 63 0 R >> endobj 63 0 obj << /Length 27979 /Subtype /Type1C >> stream Helvetica-Bold8qrstu >yV m [&2>CIP\biu{ #)3:AGMQW^fnu '-4@FR\gt}]ktradicalEcaronNcommaaccentrcommaaccentGcommaaccentkcommaaccentDeltaecaronlozengeKcommaaccentcacuteEmacronRcommaaccentRcaronDcroatzacutenacuteLcommaaccentdcroatTcaronUmacronemacronlcommaaccenttcommaaccentohungarumlautabreveuhungarumlautuogoneklcaronSacuteUogonekEogonekLacuteZdotaccentAogonekdcaronIdotaccentamacronIogoneksacuteracuteEuroCcaronimacronscedillaScedillaomacrongcommaaccentiogonekOmacronncommaaccentaogoneklacuteEdotaccentrcarontcaronscommaaccentCacuteedotaccentumacronAbreveZacuteNacuteUhungarumlautnotequaluringTcommaaccentUringlessequalRacuteeogonekgreaterequalLcaronScommaaccentzdotaccentpartialdiffOhungarumlautsummationImacronccaronncaronNcaronAmacronGbreveDcarongbreve003.000Copyright (c) 1985, 1987, 1989, 1990, 1997, 1998 Adobe Systems Incorporated. All Rights Reserved.Helvetica is a trademark of Linotype-Hell AG and/or its subsidiaries.Helvetica BoldHelveticaHelvetica-BoldU;9Zp4bIp7|>qa- 9 v 7 x > n  X  } Mo<y3`pvt,jzdkkx:i3In<Pz%H  F ![!u!!""+"W"o""##8#m###$s$%)%%&&&'g(({(() )U)*5*l*+-+u++,%,-2--.]..//04001H12W22303o3344845 5r56967R778`889F9::;X;<=z>>l>?S??@@O@wAAsABHBCHCDDvDE/EEF1FXFFGSGH@HwHIIfIIJKKWKKL&LLM!MMN#NO.OOP5PQQxQQRHRRSST)E6~)9Ur[-Ow/Ed^ƎqQ>TxjZ2v222h__gh``g$%;8('9:&oJA"mmQ%;8('9:&h__gh``gx =v.WW4.2 bw, &i 6 %tBkG*_0ʷF vYXXYYXXY1&*j&*&7bye~V˸k1&*j&*&*1vwju w x$`$;;<;;<$KۡFKKuE;;uKv}w }=} ZVgEwh \ >_ϩU\;Xg..48yк$L=w{xnOM $i*auv1wE Fu@o")ES*;d m dXjM*1vwjVx w Xj(('+*+ w``? H 'H @Y1Z&w e>͠R;j% }51 Rx@t7{ÈPmpux2~IV#^긷xmr+z}JLcMpeŶŔ;}& @w }$FLr)12h<7}\ |b΍Ov2 &L# 1aZiu} $`"VrsGD!͢ǟWi":~7H@@-\W-;}& @w$} b ua1 #1L& 2ɠǭ|H ߩ56'D ;m $y 7<zc( #1LN2߮K5gg@:,\-űٵE5Bs:,8o;v@ @w ]  :#?Od_y b ܻId 1vw  U  1jw e Zp}r˞  vwbw e<x<UPb@D^ b 1vbw eb b Zv@#  ? ?  :#6dPqygh>-dRhy ŠߋL^ ʤѴq< ;v@#  ]  :#&cOkx ܻId ;} $$T##3TT3##T$Gw-wϟ-G;NvU  |$X<7Lr)12iw nV2 &L# -dZaq;NvU }w$~ 6<we09G#(0;ѿ w ʭ|'XYI8f v=vww  Ɵ"6kWUn}$U *#:Z'=[2wzhC3o$"a */XNחgi r8 $C'F] R4;} 8vw [ x ,Mq]`[ Oëīx@ vwp)0S'*v$wX$8;!@8)*$h$vvwC93/1/>BI=44Ajw(0XB~oXYS`j5C`X^XXCkӟX8L>`-\MI}o/}M\-`/u|||XoI\>L83gmX6wkCw6XmgX^3ض\͙ ;ib`{htrecpef`ediHg_au1yyy|ɬ!.*&&!&K.KcA}1v` vw$lfϳ͢s5JGWs6R{|}H@@1`i W-"rsGDynv{ /vVu a | #]񉗞XGM#GOCYtFQOzxbnC,G{*̝|̾b{s`wityztxngiz` vmw>Z=@mvfwn)*"$*/O7@_O_ff`_9f-v(wtoq lbgq#r^x4*R!yh\xqts|%*ܘLO >-0om\#%-C4/RevWnbbM4eg-=x|iwXNHzZFdtҫ٣UIN|xml{wp|1px!tbMcʳɵ[LLaYM%Ix}))}xI))na]_a}xl)II)zp}__]clYSw`S)SZ&w `>͠R;j% |>͠R;j% v;;;$ ;$';$ ;$'v;x;$ ;$'v;K'3;$ ;$;vD C wD0ܠxb+Oa`>'D C U  ;vD! C wD0xb+Oa`>'D b b w!owgCooCCCewfDeeBBBBmmDDD1@66_fg^^gg^jjS"e" I"V-CA0/BC/1 egIvXė۬ S egIvXė۬ |egIvXė۬ S egIvXė۬ |egIvXė۬ v;;%'3;$ ;$3'3;$ ;$ɋ&*K*K*p&*&*&*&*&*&*5vyqhhoqjjo'2CB32CB3I"mA62CB32CB3qhhoqjjo`2CB32CB3qhhoqjjo;W h!*&!Cyx`l>T_[:XXzB!\~G1aTٴ̕"&!&&t-&.&.-&&y&9; 7zH(uHztj}}ii|t^ovqxyqmwH(ޠ婐:AJY]7Ic!)zmmW̿4QYYQbLLbŴSnttnnttnx,7w~trq}vvmqu[w¡ԾPoR&q.-& &.-&xQv/skxvrͮ7Js_[LWbԭ&K9L&w|||!|ɋ +A'+<b1-k-$%Vh3ZDB})jyy}9Q_iMIpɨhy|3dbscyt;+w]w*_B*+T=xmw**|Wa:2;(V,b 9T6.eE m_K!z]ܶ}^Yi\N]Y:_Vcx"N+"''vjasd/t@]ED= ߭vYjN'b]Y7^% wC%T2YY0>>0)Wo_XXo_WZ}' Wm$nX0ecwd峇%"8ajlsqW5 m1mdwiJu$ykEK t٫fZ|RM^U[lƯ“זuѓq51vw  1vvPw 4Y 4Y= ;} 8v@ w$$8qloGw-boxrϟ~uUlhFBYLI#3T:M]B>ndx#Ttf}  $ m$w0ecwd峇%"/_aefeCB#3TwT3#Vl` lGw-wϟ-G oѓq5;}&3vC Q ( =L!^JAK1{YF?m=?6kta3~ aEE`EY8[cb\[bcZ1[cb\[bcZ/Pw>BBAKX15XXYcEH&ow[ju8S0MRYNƯE3b~x ?#FM",+a^tdfG\]GG]\GB &) AB *&B YY;} jw$$)%ef =XnM%_opsZ{u\Wh``dNt''(b#B#w(B 9 viAA<@AAABAAAx((7bAb2JK,.-&v(Rw&>x((7bAb2JK0,&9v(Rw]x((7bAb2JKWv(Rw&>x((7bAb2JK-&.v(Rwÿx((7bAb2JK^QYYQbLLbŴSnttnnttnv(Rw_>x((7bAb2JKhztj}}ii|t^ovqxyqmw􅝯ޠ婐xָv-S3yQ\8X_:`*4(kM%{ =z_Hw~trq}vvmqu[w¡ԾPo=+sN+&'bb"N+:.-&sN+&'bb"N+d&9sN+'Ybb"N+WsN+&'bb"N+[-&.1vbw&*jb*b*<.-&1vbw&*jb*b*<&91vbwvb*cjb*b*'W1vbw&*jb*b* -&.vbw_ n2b *b iaztj}}iܘi|t^ovqxyqmw셝ޠ婐x&**b,,b*]Y]]Y::].-&x&**b,,b*]Y]]Y::]&9x**b,,b*]Y]]Y::]5Wx&**b,,b*]Y]]Y::]-C-&.x_**b,,b*]Y]]Y::]ztj}}iܘi|t^ovqxyqmw셝ޠ婐sx& $q2+pl1)Cm]Ϡ?k$P$p}`!;2qpyy|S?")ES*<.-&svbwAg*^1U>")ES*'W;d& m d#<K9L&}51& R|@t7{ÈPmpux2~IV#^긷|mr+z}JLcMpeŶŔ.-&}51& R|@t7{ÈPmpux2~IV#^긷|mr+z}JLcMpeŶŔy&9}51 X;y@t7{ÈPmpux2~IV#^긷ymr+z}JLcMpeŶŔvjW}51& R|@t7{ÈPmpux2~IV#^긷|mr+z}JLcMpeŶŔ-&.}51 ol@t7{ÈPmpux2~IV#^긷lmr+z}JLcMpeŶŔ{1QYYQbLLbŴSnttnnttn}51; 7 Ri@t7{ÈPmpux2~IV#^긷imr+z}JLcMpeŶŔriztj}}ici|t^ovqxqyqmwcieޠ婐xָ $y"5_w¡ԾPo;"rsGD!͢ǟWi":~7H@@ $F~\Dw~trq}vvmq}&$m$0ecwd峇%"}uaKoC*7ѓq5C.-&}&$m$0ecwd峇%"}uaKoC*7ѓq5`C&9}$ZT$0ecwd峇%"}uaKoC*7ѓq5 .W}&$m$0ecwd峇%"}uaKoC*7ѓq5(-&.1vw&   n.-&1vw&  n&91vwvg h #YW1vw&  -&.;v@# ; 7 ]  :#&cOkxɀ ܻId uztj}}ii|t^ovqxyqmwޠ婐;} &$$T##3TT3##T$Gw-wϟ-Gx.-&;} &$$T##3TT3##T$Gw-wϟ-GIx&9;} $jk$T##3TT3##T$Gw-wϟ-G7cW;} &$$T##3TT3##T$Gw-wϟ-G?-&.;} ; 7$$T##3TT3##T$Gw-wϟ-Gˁkztj}}iǘi|t^ovqxyqmwǖӅޠ婐}&$U *#:Z'=[2wzhC3o$"a */XNחgiK9L&;} 8vw& [ | ,Mq]`[ Oëī|@Y.-&;} 8vw& [ | ,Mq]`[ Oëī|@E&9;} 8vw NN y ,Mq]`[ Oëīu@mzW;} 8vw& [ | ,Mq]`[ Oëī|@-&.jw&(0XB~oXYy.-&jw (0XB~oXYdWS&`j5C`vK9L&"]C޳#'#'CsN+&'bb"N+-K9L&xvbw  n2b *b <-mficؓŮxv=vww v Ɵ"6kWUnz%-mficؓŮx4v v-**o@1;%l~j% XLo1o*4#pMW1Ao@̷@1I-mficؓŮxvwbw |e<x<UPb@D^ b #Y-mficؓŮcw?vJ{2=c}&$m$0ecwd峇%"}uaKoC*7ѓq5CK9L&ŖvRxvbw*rU<V*b*ZY-mficؓŮ} &$`"VrsGD!͢ǟWi":~7H@@-\W-T.-&sN+'bb"N+)Ax齞 T'**'/e)Afi:kkPңh!S'TOSeDep=X-mficؓŮ T&'**'/e)Afi:kkPңh!S'TOSeDep=K9L&T.'-r.Yb:x$zh b&T::S&`j5C`.-&;v@# & ]  :#&cOkx ܻId X.-&;xw*xvb*b.H-mficؓŮ;}& C$} Fߩ56kmXWWbԭ}&$U *#:Z'=[2wzhC3o$"a */XNחgi.-& v=vww&  Ɵ"6kWUnn.-&x$qA''012sYd,vbc,:>lgTuL;nŃ,^q嚲ɲotvx&-@w4(kM%SH0*3yQ\8X_:`YK9L&1vw  &Ayָ$| ]6w~trq}vvmqu[w¡ԾPo#XNחgi*#:Z'=[2wzhC3o$\swָ&v  6$7w~trq}vvmqu[w¡Noэbe1)Cm]Ϡ?k$P$p}`!;2qpyy|S?g<JY]7Ic!)(7bAb2JK;d& m d0<.-&vbw& n2b *b n.-&xw&--b-m4aY$EQf-pCQ_D{IQ[A.-& &.-&" ?]0 bEO {? &#7% l;} 8vwÿ  |{24QYYQbLLbŴSnttnnttnO  ,Mq]`[ Oëī|@;$v{*mm*Y-rt\c㖺xwÿ-ç-jQYYQbLLbŴSnttnnttn -m4aY$EQf-pCQ_D{IQ" w E&&bb T&'**'/e)Afi:kkPңh!S'TOSeDep=,.-&x2$$0ecwd峇%"}uaKoC*[qkaUWbԭyskxvrǶß7ѓq5" w  Jbb&&;]*avb*b?f{i[םŴs$ $q2+pl1)Cm]Ϡ?k$P$p}`!;2qpyy|S?x((7bAb2JKAx4v v-**1;%l~j% XL1o*4#pMW1A̷}1JY]7Ic!)j&'-r.Yb'$zh b&K9L&;m $y 7<zc( #1LN2߮K5gg@:,\-űٵE5Bs:,8ou{JY]7Ic!)xba, xbj* Cy G endstream endobj 64 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /FIFHGD+MHei-Medium /FontDescriptor 51 0 R /CIDSystemInfo << /Registry (Adobe)/Ordering (CNS1)/Supplement 3 >> /DW 1000 /W [ 13660 [ 278 ] 13662 [ 278 ] 13664 13669 556 13671 [ 556 ] 13673 [ 556 ] 13713 13714 556 13715 [ 500 556 ] 13717 [ 556 278 ] ] >> endobj 65 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /FIFHHE+MHei-Light /FontDescriptor 54 0 R /CIDSystemInfo << /Registry (Adobe)/Ordering (CNS1)/Supplement 3 >> /DW 1000 >> endobj 66 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /FIFHOC+MHei-Bold /FontDescriptor 57 0 R /CIDSystemInfo << /Registry (Adobe)/Ordering (CNS1)/Supplement 3 >> /DW 1000 /W [ 13727 [ 556 ] 13681 [ 667 667 ] 13735 [ 722 ] 13702 [ 667 ] 13704 [ 667 ] 13656 [ 333 333 ] 13662 [ 278 ] 13715 [ 500 ] 13717 [ 556 ] 13719 [ 556 556 ] 13723 [ 500 ] 13725 [ 833 ] ] >> endobj 67 0 obj << /Type /Font /Name /ZaDb /BaseFont /ZapfDingbats /Subtype /Type1 >> endobj 68 0 obj << /Type /Font /Name /Helv /BaseFont /Helvetica /Subtype /Type1 /Encoding 69 0 R >> endobj 69 0 obj << /Type /Encoding /Differences [ 24 /breve /caron /circumflex /dotaccent /hungarumlaut /ogonek /ring /tilde 39 /quotesingle 96 /grave 128 /bullet /dagger /daggerdbl /ellipsis /emdash /endash /florin /fraction /guilsinglleft /guilsinglright /minus /perthousand /quotedblbase /quotedblleft /quotedblright /quoteleft /quoteright /quotesinglbase /trademark /fi /fl /Lslash /OE /Scaron /Ydieresis /Zcaron /dotlessi /lslash /oe /scaron /zcaron 160 /Euro 164 /currency 166 /brokenbar 168 /dieresis /copyright /ordfeminine 172 /logicalnot /.notdef /registered /macron /degree /plusminus /twosuperior /threesuperior /acute /mu 183 /periodcentered /cedilla /onesuperior /ordmasculine 188 /onequarter /onehalf /threequarters 192 /Agrave /Aacute /Acircumflex /Atilde /Adieresis /Aring /AE /Ccedilla /Egrave /Eacute /Ecircumflex /Edieresis /Igrave /Iacute /Icircumflex /Idieresis /Eth /Ntilde /Ograve /Oacute /Ocircumflex /Otilde /Odieresis /multiply /Oslash /Ugrave /Uacute /Ucircumflex /Udieresis /Yacute /Thorn /germandbls /agrave /aacute /acircumflex /atilde /adieresis /aring /ae /ccedilla /egrave /eacute /ecircumflex /edieresis /igrave /iacute /icircumflex /idieresis /eth /ntilde /ograve /oacute /ocircumflex /otilde /odieresis /divide /oslash /ugrave /uacute /ucircumflex /udieresis /yacute /thorn /ydieresis ] >> endobj 70 0 obj << /Type /Pages /Kids [ 87 0 R 116 0 R 1 0 R 5 0 R 9 0 R 13 0 R 17 0 R ] /Count 7 /Parent 71 0 R >> endobj 71 0 obj << /Type /Pages /Kids [ 70 0 R 83 0 R ] /Count 12 >> endobj 72 0 obj << /Dt (D:20040814185135) /JTM (Distiller) >> endobj 73 0 obj /This endobj 74 0 obj << /CP (Distiller) /Fi 73 0 R >> endobj 75 0 obj << /JTF 0 /MB [ 0 0 492 667 ] /W [ 0 10 ] >> endobj 76 0 obj << /Fi [ 74 0 R ] /P [ 75 0 R ] >> endobj 77 0 obj << /Dm [ 492 667 492 667 ] >> endobj 78 0 obj << /Me 77 0 R >> endobj 79 0 obj << /D [ 76 0 R ] /MS 78 0 R /Type /JobTicketContents >> endobj 80 0 obj << /A [ 72 0 R ] /Cn [ 79 0 R ] /V 1.10001 >> endobj 81 0 obj << /CreationDate (D:20040814185135Z) /Producer (Apogee Series3 Create v1.0u1) /ModDate (D:20040814203430+08'00') >> endobj 82 0 obj << /Type /Metadata /Subtype /XML /Length 820 >> stream 2004-08-14T18:51:35Z Apogee Series3 Create v1.0u1 2004-08-14T18:52:48+08:00 2004-08-14T18:51:35Z 2004-08-14T18:52:48+08:00 2004-08-14T18:52:48+08:00 endstream endobj 83 0 obj << /Type /Pages /Kids [ 21 0 R 25 0 R 29 0 R 33 0 R 37 0 R ] /Count 5 /Parent 71 0 R >> endobj 85 0 obj << /Pages 71 0 R /AGFA_PSE_V (Apogee Norm PSE 1.1 31 ) /AGFA_NORN_V (ES15.103 V02) /Type /Catalog /JT 80 0 R /AcroForm 86 0 R /Metadata 82 0 R >> endobj 86 0 obj << /Fields [ ] /DR << /Font << /ZaDb 67 0 R /Helv 68 0 R >> /Encoding << /PDFDocEncoding 69 0 R >> >> /DA (/Helv 0 Tf 0 g ) >> endobj 87 0 obj << /Type /Page /Parent 70 0 R /Resources 88 0 R /Contents 97 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] /Rotate 0 >> endobj 88 0 obj << /ProcSet [ /PDF /Text /ImageB ] /Font << /F1 89 0 R /G2 91 0 R /G3 92 0 R >> /XObject << /Im1 112 0 R >> /ExtGState << /GS2 113 0 R >> /ColorSpace << /Cs7 93 0 R /Cs8 90 0 R /Cs9 94 0 R /Cs10 95 0 R >> >> endobj 89 0 obj << /Type /Font /Subtype /Type1 /FirstChar 32 /LastChar 181 /Widths [ 260 388 520 520 520 852 704 260 315 315 519 600 260 333 260 296 520 520 520 520 520 520 520 520 520 520 260 260 600 600 600 463 800 648 574 574 667 519 481 667 630 296 389 611 481 852 667 685 556 685 593 537 500 630 611 852 611 592 519 315 296 315 600 500 222 537 574 444 574 537 370 574 556 278 278 537 278 834 556 574 574 574 389 426 389 556 519 796 519 519 426 333 222 333 600 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 260 520 520 260 260 260 260 260 800 260 260 260 260 260 260 260 600 260 260 260 556 ] /Encoding /WinAnsiEncoding /BaseFont /Frutiger-BlackCn /FontDescriptor 96 0 R >> endobj 90 0 obj [ /Separation /PANTONE#202655#20CVC /DeviceCMYK 105 0 R ] endobj 91 0 obj << /Type /Font /Subtype /Type0 /BaseFont /MHei-Xbold-Identity-H /Encoding /Identity-H /DescendantFonts [ 100 0 R ] >> endobj 92 0 obj << /Type /Font /Subtype /Type0 /BaseFont /MHei-Light-Identity-H /Encoding /Identity-H /DescendantFonts [ 111 0 R ] >> endobj 93 0 obj [ /Separation /PANTONE#202685#20CVC /DeviceCMYK 108 0 R ] endobj 94 0 obj [ /Separation /PANTONE#202655#20CVC /DeviceCMYK 106 0 R ] endobj 95 0 obj [ /Separation /All /DeviceCMYK 107 0 R ] endobj 96 0 obj << /Type /FontDescriptor /Ascent 746 /CapHeight 679 /Descent -182 /Flags 262176 /FontBBox [ -119 -250 1000 949 ] /FontName /Frutiger-BlackCn /ItalicAngle 0 /StemV 158 /XHeight 496 /FontFile3 103 0 R >> endobj 97 0 obj << /Filter /FlateDecode /Length 98 0 R >> stream HWn\ ߯K9d رxLA0BnKA)c@>n,&o=Cu"IDkm/??|k۪y۷KIZo#?wT5QdUIX-߾$t/\Zj7e+XK9IFe6,rt_VO3Hŝo~Z~[^AW]w7-'eu)ܲ *A>OlOeg9} ,4lݽ]zݛ/p>w~q{7/.>]b1>|'zç`ٛ˿n9x[~>Os ˕ <> \mWr@]˕5&W&)kr-=gWbY_!6 vUHfH}~\/ju7r~uV$b_i˦Eۯ.ܢ %E}꫎Dh˕>w8yY>g]cHSbM1"n h#tnQ="9"Ȕ(y^>248i ̀h}b>8Z5l;4"OWCZR`B()./u_jMjzi xS)bIVt}Xfi2[]?Fņ ybYnJu2 ;zf`ˀKnl@Ɯߑ bHNѻMVEPTpiTHĝ@{zJ# o7sso#Ϡ;;}u^Zgޙ})VtTUwr GF*Ԃh8L4|M]iTp0!.@} g*l eVE3 CC%zEjAD_(FqÊ ,2\.\{8\saLAZ!=DQTaxq+*M.oYIEEABI\e;z> Ņ4N3bl.dPQW C,!>H7݄fkCzYQD m% 6wWѐFV5 q!EIy׆fu [ u~]঳͂8}eM"0E0ǦOlnٶ8R3%Qh9DD86EHւA"VycUye[?ݡM 2(%ڢj3XxDIX&= ghxٹm[?:fC%QsEEϦ?y pw`i\{C6e&3$ю4J{jV$MPt+8@ @({ѧ18KfIq(A%Z(/r.EE L~c0Y0K(&Lٕh2r>:{|gCcGSc?0`&%Dz37be3b\&3562}>a{6xs  t&m*""<5`l'<| ω9 endstream endobj 98 0 obj 2464 endobj 99 0 obj << /Type /FontDescriptor /Ascent 752 /CapHeight 737 /Descent -271 /Flags 6 /FontBBox [ -50 -211 970 870 ] /FontName /FINLEA+MHei-Xbold /ItalicAngle 0 /StemV 58 /XHeight 553 /CIDSet 102 0 R /FontFile3 101 0 R >> endobj 100 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /FINLEA+MHei-Xbold /FontDescriptor 99 0 R /CIDSystemInfo << /Registry (Adobe)/Ordering (CNS1)/Supplement 3 >> /DW 1000 >> endobj 101 0 obj << /Subtype /CIDFontType0C /Length 5233 >> stream FINLEA+MHei-Xbold* Yg^I "_ % $ HZjxAdobeCNS1(c) Copyright 1996 China Type Design Ltd. All Rights Reserved.Monotype Hei-XboldMHei-Xbold-RomanMHei-XboldSuppSZ!,Sp"  7 p K gC[v) # R  =  'II|,> 9-o[Q\E4g}p@fME @B7& 'n%enmJZ"@"Mrffu]XYZ%ijii]V3|,cibeӓ۴֩`JE*_/xQT@~yxsq<W ; Uhia(LL'&3c5}u&ya5^a]ld?aWZ7wqhOkAzuyNTauF .)w w'u LvCWwWvo?kDeCT_}?>F}qhnhuwoooiTߣOoCx Rp~}Gsv}}{/-9}zrfhghfd]zhw {a9!x|{y|˨ϡlC4uq"CO]\5uuNiP_  2aww5wtd2zuzqijhme1 }wjyzx)x-V5ygi7g`^@\kGqjuzo|5w~`Mm"t2ztryxvy|}pY"wj{pg|oxN w~[ Κ&/ag~zzjsqqf]uY]^`g|~|ƹ&0`hg oot\=vt~y|tvw˝8~M  C(zP onmP1}~ 2'nG~Y^Z5onn`XUŒͦ򣞽 ? AFxG~]irZbhc{k~i1R`:N>f~se8į ca_\ޠsijװxz|xwxzyz$E\e^a|lqitojvRj22ar]mJF_\^~otkqgorjB< "j.0B2euknked]ώ,ٝupt\x|dflۜ ljzyxgdg~wӌ8@UU\yts{ra&M44& & Z' }~YT6D^]7 6]~D ʠʛ MN ,r҃Ά" ,# c1v} lzML9%] v ia^뜹k{y> NLNMLMNLNu)zeza}Zc>PI3wqV}ṭkG v 2)]Jdfhgye~GnMeSbvtt~ʝwxs^ŏqnv^YcɵӧbWSqk[]~] v~e}j{zkWiJvSD%TM|JX5d`W̕_g~hyg}chinnuXXi yf]R-Ps[zٺл)kvkn~ U|zxx{}|o}~{/ & # & Z~$% ! gb !# "EG |     | endstream endobj 102 0 obj << /Filter /FlateDecode /Length 79 >> stream Hbd`20 `SQՀ$@$`-ň"B @L6 ۏBz@ՏQ0 F(0 endstream endobj 103 0 obj << /Length 13309 /Subtype /Type1C >> stream Frutiger-BlackCn3  |I 3Copyright (c) 1991 Adobe Systems Incorporated. All Rights Reserved.Frutiger is a trademark of Linotype-Hell AG and/or its subsidiaries.Frutiger 77 Black CondensedFrutigerFrutiger-BlackCn>l[Uy(HL,#O{= )  A g  9 l E > _)Hov&xB(>DWR O}I?p&Hk+@k4m, E \ s !!!G!|!!""="S"# #@#$=$x%%4%a%&j&''0''()(() )r))**l+-+t,,,,-F-----.............////!/*/3/>]dd!* j j*!ؒ]>>]dd1%&v3vp. Ɠ`x^inbjUïnuyr{^OgƳ'(Gk \@G O.b /-Ν-4% 0CNyuBЖ%ƨñfS$G>XRGRBw208ز||DC@ԥ͸0DQu=nO6Oυ2hsO*ds?Gv8w0$0.#*?U@7G 8u([gH1`iVx~A *=www Gz % 2"2Z>VcSdIRY+LYYH-3(xUS] xM|˒22$2CEN<]'2ۙPr~B-clN18u]}^<8pV#"@%q#Sś&{\m;#<!ֵq}ڋZ8t@wD1/182$V- WFD023D}}0' v622pp6y< L<.2}xsOڭ3At{aP9+N?_Iݟ vw8>8$8N8>8N8>vNw88N8[Fw38N8jQwaPuzy*vNw88ԍEX}lL@8 w8{8v&*8**NUUN*+1ڠvNw$$$]VN$x_xT z <<a0]]0aa+0]],0a<i,,jkv[2 8t [̫mFJfhXf 8- +1)s z << 5ý$a+0]],0aa0]~zi,,jv H 2'88ǡ,O@CxqwX)2 PnYjaLXXv <<YBOcK~FvRYqWN`ZwP{w3v<8<8,h,w8L8A/11AQ8kEq`IIqk8vNwlDgN<Dv0wTN$16T872 NTvNwe^DLYKD"o,oLvNwj8j8hFL#PhCFR__PTJ L i0Livfw Z#8f L i'L0'iwh`N+3Y~wZ`y ;*X/3$6$ɶՋ'[T_B,LȻ|C$RaKREw~b;}~T}!qw2/8 |Ips*kP : WBae\x2~U'CJ}ޚё=8$ 86nmjOG  ]oW:/4,<]}!qw8/22ƉxaBW : ƫ|gpw*#ޑ˚=8O}-JCX *7$T̜MI$[G\)9 3Kǖ vdUwU2cnv.ww2̔..2.,ԏ̎zlTkB860}r!83.b˙-OB|>KE#͍*܇8}h0 I$:XK˧/CJp|{ekv'ww222ΝzJ2eRQpQy2ʠvw 2220 2 2]v{w 2Llt#02 2 2Xvvww22DB78gL2ʠvw222v'w2222e8feZtue@8ceRs$pkY02͝{I2uOkv' ww222e8ceRs$pkY02ΝzJ}86824420644608¥R%%qOTTq}Wvd!2/8l2\e :I 0hPk{쯉*spI#8=EK|Ǚӏ'U}Wvd!8/2(͍*܉wpg{h0 I: Ե2q̙-O8|=KE[v w22}ז硙&t0u]Sk$pkY6w**ؔqUJ/c'S._tottqA_[ewцTU5tz[.v62p.cݾ{}umt%0.Z 1k "vvw22<2Hy_Xkn2\#7޳ģ>0_^_:F`ТA@CAa.ED\ufw|# }f\EAC@;o^A-t`F{:]p_^;ѷ>غ9D"b`9 zyyzgitrfhfjhkiXLg]au\Ep*2+$P $*$ wp wpGvvww8Xnvh uyyUXz}:/54'2px omjG bJ* E L pb,,ި޴ ibUEN%LE19j ) j1Gl#wP$x|X"#"$x""/*,$*.Gr1vPw{lUY|fgty!| +՗lvf]e?%yv &FDvg*.@>v=I&[1NUggmRQEE\levxjjlq_T`Y wz0ؽojꪦP"@x{~bh_jtt3fG SVVb]\]\}obVTTVpb|]\]]aVVTp|VV|pERO@@ROE~~ G~ZZZZ\ ;*& ;*G2ttAtt c1ccc c1cc2t c1cc2tHg c1ccv. %w2&2..2.,ΎzlTkB860222 2v.ww2&2Δ..2.,ΎzlTkB860223~~Fv/ =wWW/" "==# #Fv"T"wXX"%%T%%""$$T$$]..] l]]lk^^kqqzz%o.!F3B +<<++==+Z *GZZZZ *& *G~ZZZZ~ *& *G2ttAttg c1ccc c1cc0*$Q$Q$p $*$ * $*$ * $*$pep<2.dNjYORVd;o**o9>o**o9>dNjYORVd;o**o9>dNjYORVd&AQF*8j$ {<?XʞxiuJNgP $*$&TU&&T&&ee5>&$5]AAP gA}uwofVNmJRggn('MIF=It_M   i i  @  8NYȽYNNYYNqllqqllqrnv!U-y}xlvmdtpx]~ʩȼhZ}&[[& &&rsx`jf\^`bͫ}yfz&e$&'Z5Z'0~|~|| 0D.DDjj0x}N@0Q  So f^p@Skg%Seʽ|a\ώze{g_h w8{o  8IT  2w <<r껬o_Glhfi,\kwa7g^q]0av`]J:\K8],0a+6L D0 ܈o8?kf]|<\, >\&=Խ s"V1@)v> endobj 105 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 425 /Filter /FlateDecode >> stream H$ÃrPE۶ضm[Y3 C==K|/Y?hPiH@ p6"ݨԘ(ָՄ8MפHb &CMt7#U34+]3 fB͂< 6 \EZ\%J(+b(J[ U m9ԸZWUP5dkAVAI;m+6m׾距0``vÐawWGt_`¤); vfQӏ:? v,iXѕYXsf?º wsAu{Iwuw*58pml鶞݅ v\=[{ w݇S}<ӧs}ЗKxWf'~ӯA??3/_  endstream endobj 106 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 423 /Filter /FlateDecode >> stream H$ÃrPE۶ضm[Y3 C==K|/Y?hPiH@ p6"ݨԘ(ָ` 1^49RldH)fjffkvdB͂< 6 \EZ\%Pj?@-r[ ne[ U m9 u*JFjAVmn{v4igvhw+6g;.F>!0mG`Ǝ¬;7u~B&uq 4,XGݘZm;˺{oá݀# ɖnَ\}pmƽ=һc?чS}<'{^%^w{-|wzxҟ˾o u8 endstream endobj 107 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 394 /Filter /FlateDecode >> stream H m۶m\m~ټl۶m۶"0AJ0"4aK8D"2QJ4"6qK<Ⓚ$"1IHJ2"5iHK:ғd"3YJ6"7yK>S0E(J1%(I)JS<H%*ST:5I-jSԣ> hH#ӄ49-hI+Zӆ=H':Ӆt;=I/zӇ? 3 c8#(F3c<Lb2S43b6s<泀,b1KX2b5kX:ֳlb3[6b7{>s0G81s4g89s\2W5s6w=<1Ox3󂗼5ox;|3_77?e endstream endobj 108 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 650 /Filter /FlateDecode >> stream H ˶m\--۶mZmy˶mۘm۶w  (&ND$MB$)29R:%ibTKM4dӒ)ӓ%YcdDB;+y7;r?I\M<ER,S%c.D”P(Q8bT)IRT+MX 5R@Sy*S?6Bê4CiԠiMբylQЪ&}vh_ ;5s#^kx o7a>;ݣw >S|rOY,_|u7]+O:M~3u=]W endstream endobj 109 0 obj << /Subtype /CIDFontType0C /Length 3114 >> stream FINLGB+MHei-Light* nfnI "_ % $ HZjxAdobeCNS1(c) Copyright 1996 China Type Design Ltd. All Rights Reserved.Monotype Hei-LightMHei-Light-RomanMHei-LightSupp!m"  W =x t: 0I0>#STp&F>HFB&0I10&BFHF>&ppTS>#p^4ivTPS2 0zmj\7Q;KAq뜢=Q`ي%2;ɸɸ(׿挶(bZ?KBKIROUWKW.r<3=)Pvd" /pQ 1/19p%S@ &qrZXXw;"Re7S\-KOcb_`a=ѯ0;9B8B!~}}uo]e*1fhi;RR:RSb99a<<7AAPHj"r8; kjWKh#~~vjjcZgu[UWg__lwVfFreOZX)$JQe$'k J92h|G!3hb``qonfk0h~]|]}^9Ma荒Y3O4F;`u 茆Êa<2t3?!A8j>?Auceqdmd4b\c`Yc!s.0BEM!)d|SzTvUeG,^1JFmۊx!6~~}td_^C"!!!x3J:_$/H T;>7qphhjxVTR}3]fg.X5 Яզۢэِ:$)|*qltw}|efg_ԓÌҎb` rXQFL6CvmtiB*+nq86"?A$!Mɵ=o3Z˶ѴāMVRcMjozłH"Es}|IqIhIpaad UJ#Ɋ$J#$ɊUFկ=,I9y(vzxttt[`E̱KհDZ߱կﵸb׵y89hsdoehfCr $|eU{@]a"rsrAsr7 Bc4`3ZadS^Za ]ϯͯӰȮԲݲZгAAZZ&CV&VlY&Yb%SSNfCTT3jWcj3Y> stream Hbd@ FG9p@1P B Tq֠;; N(`Q0 T endstream endobj 111 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /FINLGB+MHei-Light /FontDescriptor 104 0 R /CIDSystemInfo << /Registry (Adobe)/Ordering (CNS1)/Supplement 3 >> /DW 1000 >> endobj 112 0 obj << /Type /XObject /Subtype /Image /Width 872 /Height 820 /BitsPerComponent 8 /ColorSpace 94 0 R /Length 715041 >> stream IJKJJKJJIJJIKKKLKKKLIHIJJKKJJJKKKLKLLLLLLLLLLLJLMLLKLLLKKKLLKLMKLLLMKMLLLLMMLLLLLLLLLLLLLLMLMLLLMNQPPNNLMMMNMMMMLMMMNNNMNMNMMMMONNONMOONMMNONSVWWUTRQPPOOQOPPOONOQOPOOPPPOOOQPPPPPQPPRQRSY]]\ZWVSRSRRRQRRSRRSRRRRSSRQRSRSRRRSSRRRSTSZ_`_\YWVUUUVUVVUVVUVVTWXWVUWVWXWXWWXWWWVWWX`jlhfb^\[ZWWWXXWXXXYXYZYZ[ZZZYZYXZYZZZYY[ZZ_mvvqqomjhca`]\\]\ZZZZ][\[Z[YY\[YYZZ\^[Y[Z]erusoiecb```_^`_^]^]^`_`]_`]^__`_`a``]`_`isqld^\\[[Y[[YZYWXXWXXXYYYXZZYXXYZXZZXXZWZ_mvtqqpoomlkhigfffeedbdccdaacfccdb`ababbbclssrrplkkjiihgiffeca`dege\YWURSSQOMKMLMS[ZTMEDCB??A@@?@AA??A@?@>@B?@?@@??@???@>??ESWUSTQNLIJHFGFFDFHFEEEEEFHGFGFGGGHIGIHHLW[ZYXWVSROMOMLKJKMLKKMKKKKKLKJJJJJMLMNPU^a^\\XVRPOLKLJIIHJJKIKJIIHIGHIIIJNYnvsok\Xn|vnb[SKHE@:;9;99;=?>?@>?>??;<:83//--.,,,.5=?:43121223015575:::==>>?>;??>@EILNNOUYRJIHKJJJJKKJIHHCCDDFEEEFEGGHGHIJIIJIIHJHHHIHHFFGFFEEEFFDFFEBAACB@DCBCCDBBBABCDDEGHJKJJHD?965333345KKKKJKLIHJKILLKKJJJJKIJIIJLJLKKLNLKLKLLKLKKLLLLLLLLLMLLLLLLKLKLLLLLLLLLLLLLLLLLLLLLLMLLMLMLLLLLLLNQPPOMNMNLNMMNMONMMMMOMNMNOOMNMNONMONOMNMNNOSWXWUTRPQQQPOOPPOOOOONPPPPOQPPPQPQPPQQPRQRRRX]\\ZWVTSRRRRRRQRQRRRRRRRRSSRSSRSRRRRSRRSRSZ^`]\YVVVVVUVUVUVVUWVWXVWXWWWWWWUVVVXXWWWWW`jligb^\ZYWWVWXXYYXWYZYYXYZZYZZXXZZZZYZXYZZamuurpolkfca^]]]][[[[[Z[[]][\]]Z[Z[Z[\]Y[Z]eqvqnigda__``]]]]^^`___`__`^_]``_^_`__^`aksrkea^[Z[[[X[YWZWXWXXXXXWYZZX[[X[YZYZYYXZanuvrqronnljiihgfeedec`bbcccabaccbbaabcccckrsqpolkkiihfghggfc`^cdgc]WVSTRROPOMLKNUZYTLDBBC@?A?@@AA@?>?>@@>A@?>?A?AA?>?@@??AFRXWTSQONJIGHHGHDFHFFFGHEDHHFGFIIJIIJHIFLV[ZZXWTRPNNNKKJMLLLJKKJKKJJKLIIJJJMLLMNW^]]ZZXVQPMMJIIHJJJJHIHHHIGHHHIIIJM[ottniZXr{vlaXQIHD@=<;;:;=>AAA@>>;64/.,,/,,+-2884232235333254657;:;:<=><;=??BGJLMNPWYSKIILKKKJKJKHFDBBACFHFGHGHHGFIIIKJJJIIIJIIIGGGGGGGFFFFFHFHED@A@@BAADABCDABABABEEIIIJJKJF>:73322444JKJLKKJIJJKLLLKLLLKJIJJJIJKLJKLKKLLKLKLLLLLLLLLLMLLLLLLLLLLLLLKLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLNNPQPNNMNMMMNNMNMNMNNNOMMMMNNNONOONNOOMONMOOOTXWWWTRPPPOOOPOOOOOPNPOPPOPPPOPQPOOPQQPRRRRSX]][ZWUSSRQRRSQRRRRRRRSRRRRRSRRRQRSRRRRSRSSZ``^\YWVVVSUXUVVWWVUUWWVWXWWWVVWWVVWWXWWVWV`jmhhc^Y[XXWWWWXXZ[YXYYYYYXYYYZYYYZYZXZY[[Z^muurpokjfcb_^\]^[\]\[YYZXZ[Z[[Y\[Z[[\\\ZY\dquqoieeaa`a_^^]^^__a__`a^`^__]^_^_```^^ajtqle`][\[[YZZ[YYXWWXXWYXXYXYX[Z[[YYYZXXYZaovtqronnmjkifgeefcfddaccecdddccdcba`cdaadlssponmkliihggfhgfd`_`dgd]WWVTTQONLNLLMT[YTJDABBA@A>??@@@A@?@????>AA???A@A@?@?@>@GTYWSSPNLKIIIHHGGEEFGFGGFFFGGFIHIIIIHHHFMWZYZWUURPOOMKLKLKJKLLJJJJKIJKIJJJLMLJLNT]]\[YWUQNMJKIHGIIHHIGGHGGIKKJHKHJL\pvsniYYr{uk_YRLGB@?=<:98<>BAAA@<===<<<830-,,-,++.48843324654223346678788;<<<:=@@AHIKMMQXYRJILNLLKLKKJIGCABCEJHHIGHIHFGIHIJKJJIIIHIIHIHHGIGFGGEGGHGGEDA?A@CDCA@BDDCAABBCFFIIIIKKIC=:64334555JJKKKKJJJJLLLKLKKKJJKJJIJJJKJJKKLLLLKLKKKLJLLLLLLLLLLKLLLLLLKLLLLLMLLLLLLLLLLMLLLKLKMLLLKLLKLLMLMPQPOONOMMNMLMOMMMNLMLOMNNNNNNNMNNNNONONMOONNSWWWVTRQPPOOOPPOOPOPPPPPPQPOPQPQPPPPPRRRRQRSY]\[ZXUSRSRRRRRRRRRRRRRSRRRRRRRRRRSRTSRSRRSY__]\YXVVUTVVUSVWVWWVUUVUUVWVUVXWWVVWWXWVVV`ilhge^YYXXWWWYXXXYZYYYXXXXYWWWYYZXZX[ZZYYZ^mwtpomkifba`]]\[]\[\\[ZZ\\]\][YZZZ[Z]\[\Y[dquroiebc`__^_^]^^_^^^___``^\\]\_`^__`_`alsrkf^]Y[[[YYXXXXYYXWXYXWXYZZYXXYZZYYZYZXYcnvtrqpnmlkkhjhfdeedcbcdddcccccbadbaaaaabeltrqpnmjkjiigfhggee_^`dd`]XWVSTPONJLLJMU[YSKCABA@@A@B??@?=>?@?@??@?A?>??@@@@?@A@?GSXVUSOOLJIHIFFFGHFFHFHFFEFFEGFFGGHIGHHHLV[XZTUSSONMLKLLLJKJKJKJLIJIJKKKJKJILKNMT]][[XWUPOLLJIIHIJIGHFFGGHHIIJIKHIL\pvqngXZs{tj^YOJEB>>>:;::=>?@?B@>=<>><=730--,,,,-06<323334664432248667778;<=;:>>>BIIJMMSYXRJJMLLLKKLKJKDBCCFIJHIIIHIHGIKJJJJJIIIIIHJHJHHHGGFFFGGHHHHFA@@>@CABA@ADDCA@ACEGGHIIJKJHA<:85334454JKKKKLIJLKLKKKJLJLKKLJIJJIKJLKKLKKKKKKLKLKKLLLLLLLLLLLLKLLMLLLLLLLLLLLLLLLLLLLKLKLLLLLLLLLLLLLLMMPQPPOOMLOLNMMNMMMONNMNONNMNNMNNNOOMNOONNNNNORWWWUSRRPPQOOOOPOPNONQOPPOPOPPOPQPPRPQQRRRRSY\\\ZWTSRRRRRRRRRRRQRRRQQRRPRRRRRQQSRSSRSTUY^_^[YXWWWSVVTUVVVWWVUUUVWWWWWWVVWWXXWWWWWV_ilieb^ZYYXYXXXZXYYXXYXXZZYXWXYXZYY\Z[ZZ[XZ^nttomlkheb`^]\\[\\[[][[[[\]][\[\]^]\]]ZZZ[gpurnkgca```_^^\_]^^`^^]_``^_`_^`^^___``_lsrke_[ZZ[ZZZZZXYZZYYYYXXWXXYYY[Z[YYYZZ[YXcowusqpnmlkjhigfeececcddeeacdbaaddbbcbaaadmsqqnomlkjijheggfge`]^^_a]ZVUSRONLLLLKMTZXSKEABB?>??>A?>>=>A?>@>>???>@@>@@?@A??@?HUXWURPOKJIGHGGIIIGHHFFEHFGEGHGGHHHHFFGJNX\YWWVRRPMNLJMKLLJLKJKJKJIIKKKLKKKLJMNNU[]\ZXVTPOLKHHHHFHIHHHGFEHJGIHIJJIN`qurneXZw}vi_YOJEA<==9:;<=?>???>>>@?A@?@@?>>>?A>?@A?>??HUXWTSPOLJIFHIHFFHFEFEHHGGHEIGEGFGFGFGFHNY\YXWUSRPNMLLKKLLLIKJKKJJIHJKKLKKLKLKLNT\\ZYWVRPNKIHGGGIHIFGFGGHIHFFIIIKJO_surncV[y~ztg]XOKG@=<;<;:;;;<=A?@?>>?>:842/--,-,,-/23004223886335455447567;9988:;=DIKOPPSXXPJKLMLLLKKIIGGFIIJKKIHJHIGIIJIKJJKJHJJJIIIIIHHHHGGEGHHHGHGDBA@AABABBCBCCCAADDEGGIIIHJHE@=;96444455JKLLKKJIKKKKLLLKKKKKLKLLKKKKKJKKLLLLKLLLKLKLKLLLKLKLKLLLLKKLLLLKLKMLMLLLLKLLLLLLLLLLLLLLLLLKLMLMMOPPPOONNMMNNNNMMMMMNNNMNMNNONOOOONOONONNNNNPRWWWTTRQQPOPPOOOONPOPOOOOOQQPQQPQQPPRRRRQRRRWZ\ZYWTSSSRQRRSQRRRQRRRRRRRRSSSQQQRRSRRSRSUY^_^[YWVUVUUVVVUWVVWVUVVWWWWVWWXWXWWVVWXWWX_ikhfb^]YXZWXXYXWXZYXWWXXXXXYWYYZZXZYZZYYYY^nuqnmjkheca_^][YZ\Z]\]ZZ\[Z\\ZZ[]^\[\]ZZ\\drvrmkfcb_``a``b_`^`^`a``___^_`^_a__````cktpke`\Z[[XZX[Z[[ZYYZXZ[Z[YYYYZZZZZYYYYZ\Ybottrqromlkjihffebeedddedcbcaabecbddccaaafntqpoolliijhhhhgec`\[\_^[[XTTRQOMMLLKLMV[XOJDAAAA@???=???@>>>>A@>@AA@A@@??@AA@?@>IVYWUVROMKIHIFGHHIHIFFFGGGFFGIFHFHHFIIGINY\YXWUURPNNMMJLLLLJKKJKKJJIJKKIJLLKLLJMS[\YXWUSQLJIGIGIGEHFEGIGHIFGHHIKKIPbrtpndW^|~zth_XOJF@><=<:;;:8:>?>?@>:631.----,*+.221/1236985567444457547679778:@BAABCCAAABBEDFFHIHGHIEBA=<95533565JJKKIKJKKLLLJKLKLLLKKJLJLKLKKLLLKLKLLLLKLLLKMKLLLLKKKLKLKLKLLLLLKLLLMKLLKLKMKLLLLLLLMLKLLLLLLLLMNPPPONOOONNNNOOMMONMMMMOMMOOOOONOONONONNOOOOOSWWWVTRQPPPOOOOOOPOPOOOOOOPPQPPPQPQQQRQQRRQQX[ZYYUUSRSRRQRRRRQRRRRRRRQRRQRQRRRQRQSQSTRSX\_]YYXWUUUWUUVUUVWWVVUVVVVWVWWUWWXWXWVVVUW^ijiea`\YXYYZZYZXYYYXXZWXZWYWYXZZXYZXXYXYYZ]ntsomjjhgdba_^^]]\[[[]\ZZ\Y[]^]Z][[[ZZ[]]\drtrmjedcaa`_^``^^^_a`a````^^_^^^_^__`^_blsrkd^^[XYYYYZZZZZYZYZZZZYXXWZYYYZ[ZYY[ZZZapvvtrqonmkijhfeeceedccbcccbaabdcaaadcab`dlusqoolkkjijhhgged_^]]^^\XTWUTRPMMKMMLNV[YQJDBAAAA@>?A??AA>??@@A>???@A@=?AAA?@@?>HUZVTSRNKKIHHIHIHGFGGGGHFGGIIHFHIIHGGHGIOXZYWWVSRQNOMLKMLKJLKJKJKILKJIJJKKKIKMLMV[[ZWVTQNLLIGHGIIIGFHGFHIHHHIHIIJJQctsqlbW_|~zsg_YOJFA><<::;;:89=@?;8520,--,-+++07=7112499755675565674665886677:CHKNOPTWVNIKMMLMLIHGFFHIJIKJIIHHIIJJJKJKJJJHJJHHFIHHIIHGHFHIHHHIIHHECC@@??@CDDBAAAABEEEGHGHGIGEB?=<85433355LLLKLJKKLLKKLKKLKLKKLKKLKKKKKLLKKKLLLLLLLLKLLLKLLLLKLLLLKKMLLLKLLMLLLLKLMLLKKLLLLLLLMLLMLLMLMLMMNOPPPONOOMLNONMMMNNMNMMNONNONONOONOOOONMNMOOORVWVURRPPPPOPNOOOOOPOPOPOPPPOPQPPPPPRRQRQRQRVZ[ZXXTSSRRRSRQQRRRSRRRRRRRRRSRQRQRSRSRRRRTX^^^[WWUUVVVTUVVTWVWWVVVWVVVVVVWVWXVWVWWVVW_gjge``\ZZYYXXYX[ZWXZYYZYZZXWZWZZYZYZXZZYZY^ltromkjgfc``_\]]][[][]\ZZ][]]][\Z\[[[[Z[]\esvrniefaaa__`_^``]^_a`a^^`__^___^`__```cmupkc^Z[XWYXZYZZ[ZYZYX[[YZYZYYYZ[Z[ZZ[XYY[couusqqnnmkjihffedeffddddaaddaaccaccbb``acpurqpnmkkkijjgfffb`a^_^\\YVVVSRQNLLJLMPX[XQJDCB@@AA??@@????@??>A@@@>@@@?AA??@@@@@IVXVTTQNLJJFEFGFGHGFGGHFGGGHHGGHGHGHFGGHNXYXWWVSPPOMMLKLILJJKJKJJKJJJLLIKJHIKKKNV]\ZWWTQOLJFIIHIGHFFFFFFFFHGIIIIIJPctsnl`W`~ytf_YOID@@;;99:9:9:;;=;<>>?;631/----,+)+/:><315:9;966676755664565776787;FHHMOQTVUMIJNNLLKIGFGGHJHIIIIIIJIJJJJJKJLKJJIEDCFGIIIIIHHHIHHHHIIHHED@@@@>@BBABAA?AEDCDEHFGHIHFA?<;95633566JKLKKKLLKLKKLKKLLKLJKLKKLLKLIJLJKKKLLKKKLLLLLLLLLLLLLLKLLMLLLLLLLKLKLLLLLKLLLLMLLLLLLLLLLLMLMLMLNNPPPONNONNMNNNMNMNMNNMONOONONOONONONNNNNOONOQVWVVSRQPQOOOONOOOOOOOOPOOPPQQQPQPQRQRQQQRRQU[[ZYWTTSRRRQRRRRRRRRSRRRRSRRRQRRRSSRRSQRSSX]\\ZZVWWUUUVUUVTUUVVVVWVVVUVVVWWWWWVWWVVUX^gjheb^ZZ[ZYXWYXYZYXXYZZYYYYXY[ZXZXYZYZYXYY^kurpmjihfda`_\\]]\Z[\\]Z[\\\\\\[ZZ[ZZZZZZZcrvrqkfdba`_____``__a__`\a```^^`_^__`_``clsnjc]YYYXYYXYYXXYXZYZYZZZ[[YXYYZZZZZYYYZ\apvtrrqonljjhgfeeeeeeebabbc`dc`cdbe_aa`bbfntrrqnllliihigihfcbc`]]]\ZVVWSQNMMLKLKNX[WOIDA@@>?@AA>>@@?=?>@A?B@??@@?A@@A?A@?@@IUYVUSQRNKIIHEGIHGHHIGIHGGGFEFGGHEHGIGHINW[XWWTSQQNMNMLKKLMLIJIJKKJJIJKJJJHIJKKNV[[YXVSSPLJIJJGIGHFGHHGFIFGFIIIHIIRftsol^Vb~yqg]WMGCA>=<;8777799:9<<=<<64310,-,,++))-7>:/.2457546764654353546578897@ACFGGIHIIIHIIHIIIHIHGBA@@@>?CBBAA@@CCDCEFGFIIIHD?<<;86446666LKKKKLLKKKKKLKLJKJLKLKKKKLKLJJKJKLLKLLKLLLLLKLKKLKMLKLLLLLLLLLLLLLLLLKLLLLLLLLLLLLLLLLLLLMLLMNLMMOQQPNONMNMNNNNNONONNNNMOOOOOONNONOONNOONOOOORVWUUSRQQPOOOOPOPPOOOPOOPPOQOQQQQQORQQRQQQQQVZ[ZXVUSTRRRRSSRRRRRRRRQRRRQSSSRRSSSRSRRRSSX\]\[XWUVVTTTVVTTTUUTUWVWWXVVVVVWXWXXWWVTVV^gifeb^[[YXYZZYYXZYYXWXYWXZXZXYXZXYYYYZYYYX\luromjiieca__\]]^]Z[]]]\Z\[[ZZZZ[ZZZ[Z\[X[dsuspkeda`__^_]`__^_a___^^a```^``_]_^`a`bnsoic^ZXWWXXXZZYYZXYXXYZYYZZY[ZXWXYYZZZYZZbpvrqrponnjiiffegeeeeebcebccabcbddd`a``cccptsrpnjljihihiihfecc_\Z\][WXXROOMMKKLKOXZVOJBAA@>A@@?>?????@@?@AA@?????@@@A@@@@@ALVYVSSPOLJIHHIHGGFIIGFHHGGGFGIIJGJIJHIFGOZZXXUTRRROMLLKJLLLKILJLLKJIIJKKJJJKJKLOV[[XXWUQPLIIIJIGHHHDHJFGIGGHHHIIIIRfutpl^Ud~xqf]VNHC?><;<97677:88:::;96421./+,+,,**,/7>;0/0145435665655543553567889=CGGHMPUUSJGJKJJJIIHFGHHJHFHHHIJKJIJIIIJKJKIHB<>>AFFGIIIIHIIIHHIHIGHFCB@B@?@?AB@@@BDDDEEFFFIJHFC@=<;86555654LKKLLKLLKKKKLKKLKLKLKKLLLKKJIIJKJKLLLKLJKLKKKKLKLLLLLLLLLLLLLLLLLLLKLLLLLLLKLLKLLLLLLMLLLMLMMLMNNNPQONOONMNMMMNLMNMNNNOONNOOONONOONONNNNOOOONRVWWTSQQRQOOOOOOPONNPQOPOQOPQQQPQPQPRQQRPRQQV[[ZXVVTSRRQQQRQQRRQSQRQQQRRQRQSRRRSTRRQQQTW]^\ZWWWUWVUUTUVVUUVVVVVVVVVVUWWVVVWWWWUUVX^fhffb^]\ZYYYZXXYZYZZWWXXWZZYXYYYY[ZYZZYXYW[kuspnligeba^^]^\\][Y[ZYY\][Z[\\Y\[\Z[ZZZX[cstrojhc`__]`^]_\]^^\``]^``_^^_a_`]\____blsohb\]YYYYWZXXWWZ[ZYZZZZXXXZZZXXXXZ[[[ZYZbpvtsqrnolkihffcfdddddeacdccbaacaecb`cbaaeptpqooljjjhjhighgeeeb\][\\WXWTPOOOMMMMPY]XNHBAAAA@@A@?>??@?A@@@A@A@A@@@@A?AAAA@?BOVWUURQNJHHHIGFHHHGHGIGHHHFFGHHIHIGHGGHIOZYYXWTRRQNLMKKKJKJKKKJKIJKIKJIIMKJJJKJNX[[YVUSQQMLIIHGGIIHFGHEFGHIIIIIIIJSguspk^Te~xpf[VNHEA>=;;9774887689::96200/-.-)+***+27;8000/03345566765333434477:99>FHHILQUWQGEILJJIJHGGGGJIHHFHIIILIJJKKJJJIHFD>;<>BGGFHIHIIHHIHHHHHHIGDDCCA@?ABBBAAFEEHFFIGGIGEDA@=<<65446655LLLLKLKLKLKKLLLLKLKLLKKKKKLKLKIJJLKLLKMLKKLKLLKLKLLLKMLLLKLLLLKLLKLLLMLLLLLLLLMLMLLLLLLLLMMMMMLMMOQPPNOONNONNMNMNOOOMMOONONNNNOONONOOONNNPOOORVWUTSQQOQOOOOPOPPPOOOOPPPOPPPQQPPQQQQPPQQPQUYZYXVTSQRRRRQRQQQQQRQRQRRRQRRSRSSRSRTSRRQTY\^[YXVWVUVVTUTWVUUTWVVUVVWWVWWWVVWWUWVWVVV]ehgfc_\[ZZYZXYYXXXYWXYYXYZYYWYYXZ\YZYYYWXY_lutpnmjgeba_]]^]\\ZZZZZZYZ[[ZZZZZYZZ\YYZZ[esuroifa`_a^\]_____\^]^___`__^]^___\^^_]bmrnic\YWXXXWWWVWWWY[YYXXXZYXYX[ZXYZZZZZXXZdrvusrrnnmkihgfffecdcedcbccccecaecacb`abcdosqnoollkijjigfgegefb]\\][WWWWSOMOLMNLQY[WPFBAABA@?@B@>@@@?A>@>AAA??AB@@@@AAA?>?BOXWWVUQPLKHIGGHEIJGHFGFHIHFFHHGEGGFIJFGHNYZXWWTRRQNNLKJLKLLJKJKJJJIJKLJILJIJJJJNW\[XWVTRNNKIHHHHHIIHGHFHIIIHHIIIHKVitsom]Tfypf\VNICA>::8879678:6586630.0/0--++++)*,5<<830/024636676654333454578;<;@HFGIJNSUOGEGJJJJIFHGHHIIIGHFGJKJJJJIJHJHIHE@?=<>DGGHIIIHHHIIHHIHHIIFFFECA@@AABBDCEFFGGFFGGEEBAA?=<:55545544KLKLKLKLLLKKKLKLKLKLKLLKKLLJLJJKJJJLLLKLKLLKLLKLKLLLLKKLLLLLLLLLLKLLLKLLLLLLLLLLLKLMLLLMMMNMNNMMNNPPPOONONMMNMMNMOOONOONNOOOONNOOOOONOOOOOOONRTWVTSRQQOPOOPOOONPONOOPOPOQPPPPPQQRQRRPQQPQUYYXXUTTSRSRSRRRQQQQRRQRRRRRRRRRRRRRRRSSQPRX\]\YXWVVUVUSVSUUUVUVVVVVWVWVVVWVWVUWUVVWVV\fgffc_]\ZZYXYYYYYXYYWYYYYXYYZZZY[[[ZYYXWXW^mtspnllgeba`^^]\[[\Y[ZZXXZ[[Y[[YZXZZYYXXZZerurojfca^]_^^^`^^_^_]^]_^^^_]]^^`_^^`_^bmtoha]ZXXXWVVUXWXXZYYZXXXYYXYZ\YWYYYYZZYX\ervttrrqmlkkigegfedddcaedcbbabebedeaa`abdhqtrqnmlmkikihggfeefe`][]^_ZXXVRRLMLNMLR[\XPGCAABBBAAB??>A?AA>A@AB@@@A@ABBABAA@AABMXXVUVPNLJGGGIHIHHFGFIHFIFGFHHHHHGGEIFGHQ[[XXWSSRQNLMKKKLKKKJLKKJKJIJLLKKJJJJJKOX\ZXXTSRNLLIHJJIGFIGFHFIIIGGIHIIIJVkvsok]Ugwnc[UMIDA=;:997879875424352/./.,,*,+,)+,27841/114464776664322343246;==<;>EHGIHHHHHIHIHIIGGHHFGGDAA@BAABDDDDGHHFEGGFECAAA@><665443455KJKJLKLKKKKKKKKKLKKKLKKKKLLKKKKKJJKLLLLLLKLLLLLLLLKLKLLLLLLLKKLLLLLLLLLLLLLLLLLLLLLLLMLMLMMMMMMMOOQPPONNMNNNMNMMMNOONOOONNONONOOOOONONONOOOOORVWUTRSQPOOOOPPOOOPPOOOPOOPPPQOPQPQRPQRQQQQRUZYYXVSSRSRRRRQPRRRQRRRRRRRQRRRQRQSRRSRRRPTW\[[YXWVTVVUUTUUVUVVVUUVVVVWUWVVUVVVTVWUVVV\dgfea_\ZYYXYZYYYXXXYWWXXXYZYZYX[[\ZZ[WXYXX]ntrqolkieba_^][[Y[ZZ[\ZZZZZY[[ZYYYYYYZYXWYfsuqplgeba____`___^^\^]]^^_^___]^`_]_`_^cnuohb^YWXXXXWXXXWWYYZYXXYXZXZYYZYYZZYYZ[Z\fpttrqnnmkkiihgefeddececccdaebddcccbaabbbgqtsoonnkkjiiigggeefd_\[]`_\WWTROPONMNMQ[[XNGBC@>@ABAA?>?AB@A>@A@????AA@ABBAAAA@>CNXXVSTQNJIIIFFHJEFFHIIGIEGGGIGIJHHJHGGEHSYZYWWUSQPOLMLLLMKJKJJKKJILLIIILJJIJJJKQY]ZWWURQMLHGIIIGGHFGFGGIGGGFIHIIIKUmvsom_Ug~xpd[UKHDA=:<;887878664634540-.-,+**,*,,)-/2.-/2435446777554333322458<;>DFEHJJMQRIDCFFHHHFGEHFGHFIIHGGHJKJJJHFECCDB@>::>BGHIIIHIHHHIIHGGGGGEFEGDBAAA?BEEDFFHHHHEECDFB?BA>=;755434464LMKLLKKJLKLJLLKKMLKKLLKLKLLLKKLJKJKKKLKLLLLLKLKLLLLLLLLLLLLKLLLLLLLLLLKLLLLLLLLLLLLLLLMLMMNNNMNNMOOQQOOONNMNLNMNNOMNNNMNOOOOOONOONNNNOOOOOOOOQTVVUSRQQPOOOPOOOOOPPOOOOOPOPPPPQRQORORQPQQQVWYXWVUSSRRPQQQRQRQQRRRRQRRRRRRRRRRSRQRRSRRV[[[YXWVUUSUVUUTTTUVUUUUVVWVUVWVWVVUTWVVWTT^gjheb^][XZZZYYXXYWXYXXWWXXXZYXYY[[[[YYWVVU\ntsponmjdba^_\[[[\[\[[Z[[YYZ[Z[ZY\ZWXYYY[[fttpqic``__]\_^_^^\]]^]][]]_\\\]__^^^`\_cmtph`][ZZZXY\ZZXYYZYYWZZZYZYXXX[ZX[[ZZZZZ[dptssqpolkjjifggffeecedcddebcdedbdbbddb`dhptromnkkkjijhhhhfeed^_[\^\XVSUTRRQOLMMUZ[XNGBBA@?@@?>>@?@@>???B?>@?A?@A?AA@@A@>?COXXVVSPMMIIHFEHFHHDGFGDGEEIHGGFHFIGHHGFGS[ZYXWVSOOOMLMJKJIJJJKKKLJLKJJJIKIIKJKIOX\ZWWWSQPLJIHHEFFHHHFEHIGGHFIHGLJKYmtrml]Ui~ymcZTKGB?<::::887876652421//-,-,,,+-,)++3960//223565346755313312346798=DFGIJJMONGCCEEHJJJIFEGEDGHJIFGGIJJIHFECB@A?>=:<@CHIIHIHHHIHHGEEEDCCCCEEAAAA??ACEEGIIIGGDBCGEB@CB?=9763345655KLKLLKJLKKKKLLKLLLKLLKLLKJKKKLKLJJLLLLLLLKLLLKLKLKLJLKLLKLLLLLLLLKLKLLLLLLLLLLLLLLLLLMLLMMMLNLMLOOOPPOOOONMMMMNONNNONONONNNOOOONOONNONOMOOOPNQTUURRQPPPOPOPPOOONPNPNOPOPQQQQPPRQPQPQQQRPRTXYXWUTRRRQRRQQQPPRQRPRQQQRQQSRRSRQRSRSTQRRVZ[[XWVUUUVVTUUUWUVUUUVWUUUWVWVVUSWWVVVVTUV]ehfdc^]ZZYZXZXWXWWXYYVXXYVWYXYZYZX[ZYXVUUV]mwsqoolgfdb`^[]][]ZY[\ZYYYZZ[[ZXZ\ZZ[ZWWY\fstpoifcb^^]\]]_^^\^]^]^\^\]_`]^^_]^_^]]blupib]YZYYXW[XXWXYXWWXXYYZYYXYX\[WZZZYYZY[dqtsrrpplljkiiffeeeecbccacdbcaacddbcceabchqtsqponllkihghfehhfe]][Z\ZWUUVRSQRQPNOTZ[UNFCBAA?B@AAA@A?@@?@@@B??@B?@@AAA?ABA?>COWWVWSPMLLIHFEGEFGGGHHIHFFFIGHDFHHGHGFFIT[ZZWWVSRONOLLLLKJIKIJJJKLKLKJKJJJKIIJLQY[YWWUSQLKIIHHHGGIHGHHHFIHGGIJIIJLZmtpnl]Vi}wla[TJGC><;:;9;699764433211/-,*--+,,-*+,5==3-.11343324676442121356768:<;>ADHIHJIHIIIIGBBBAB@A@CBAAAA@?@@CDGIGHHFCEBBEDABFA=;8634433345LKKLLKKLLKLKLLLLKLMKKLKJLKLLKKKKLKLLKLLLLLLLLKKKLLLLLLKLLLLLLKLLLLLLLLLLLLMMLLLMLLLMLMLMMNMMNOMNNOPQOOOMONNNMNNNNMOOOONNONNONNNONNOONOONOONOOQTWTTSQQOOPNOPOOPOOPPOPPPPPQQQQPPPPPPQQRQQPQSXYXVVSSSRQQSQQQRRRQQQQRRRRQQQQQSQQRRRSSRSSV[]ZXWVUVUVUUUVVUUTUUUUVTUVUWWVTTVUVVWWVUVW]ehffb^]Z[ZXYYXWYWWXYYZXYZZYXXZYYX[ZYWWWXUV^nvspoplhfca^][^[[ZZZZ\ZZZY[ZZ\\XY[\[ZXXYX[grrpnjeba`^\^\]]^[]_`^\_^_^___]^^^]]_^]]antqj`\ZZXZYYYZXXZXWWXWXZZYXZYXYZZY[ZZYY[Y[fqtrqqponkkkhghegeeddcdcdccddedfbdacddbbaiptqroomkkkjhhgffhhee^]\Z\ZWVSSTRSSQROQV[[VNFDCCA?AAA@?>?A@??@@@AAA@?@A@?ABAAA@@ADPXXUVTQMJJGHFGFHGIHFFJIGHFFHGHEIIHHFGHHJTZZXWVSSROOOLKKLKJLLIJKILJMJJJLLJKIJIJLQZ]YWXUTQMLIIHDGHIGGGHIHIHHGIIIHIIM[ntpnn^Xi}vkaZTKGB>;9:898579764644323.,++,,,-,**),5;:3.0.023233576643221146768::>FEGGGGKNLF@DFGIJJHIGCBBBFIIHFFEFHGGIFE@@AA@>;=?EHIJJIIIIHIHEAC?AB@@?AAAABA@??BBDEIIIFCAABCDCACEA;;:655254445LLLKLKKLKJLLKKLKLLLKLKKLKKLKLKJJKKJKLLKLLLLLKLLKKLKKKLLKLLLMLLLKLLLLLKLLKLLLLLLKLLLMLMLNNMNMOOOOOOPOPOONOMMNMMNMNMMNMNNONOOOOONMOOOOOONOOOOOORUVVSRRPPOOPOONOPOOOOOPOOOQPPPPPPPQRPQQPQPQRTWZWWWSRRRRQRPQPQQQRQQQQQRRRQRRRRRRQQTRSSSTV[[ZZVUVUTUUUVUUUUVTUUVSVUVVUVVUUUWUVWVTVXW]fgedc`[ZZXXWYYXXWXXYYYYW[ZXXYYZX[XXWUVUUVW_nvtqpolida`]\\[\ZYYXZ\Z[ZZZ[[ZZXXY[Y\YYYXZgrspmkeba_^_]]]]\\\^_]\^^]____^_^][]]]\]cntrha]Z]YYYYYZYZXWVWXVXYXY[ZYZXZZZZYZYZYW[esurrqonmlkjigfeeedfeddbdaebcddcbb`c```bajsuronolkmihihhhgfggf_^]\\^WTVUTURRRPPOT[[VLEBABAAAA@AA???>?@AA@@A@?@@AB@AAABCAAADPYYVTRPLKJIGFIGHGHFGGHGGFHHIGHGHFHHHEHFIT\ZWVVUSRPNMKLKKKKLKKJJKJKKJKHJIKJIJIILSZ\ZXVVRPPKHHHGHGHGEHGGGIHGGIGGJIIM[ptqok]Vl}vlbYRKEA>=:9778775352454241.)*++)*,++(+,4=;50.0244455766542000226677:<@GEFIHFJMLDAAGHIJIJIECAABEIIGFDDEHFIGFC@>@@@><>?EIIIIHIIHIHGCBA@AAA@@B@ACA@>@@ABEGGIDA??AABBAABA@<=8644455344KKKKLLLLKLLKKLLLKLLLJKLJLLLLKLLLKLKKLKLKLLLLLKLLLLLLLKKLLKKKJKLLKKLLLLLLLLLLLLKLLLMLMMMMMLOOOOOPOOQPOOOMNNONMMMNONMNNMOOOOOOMNNNMOONOONNOOOOOQTSUTSPQPOOPOOOOOOPOOPPQPPQQPPQOPPQQPQORPRPPSYXVXUSQRRQQQRQQQRRPRQQRPQQRQRQQQRRQRTQSSSUVZZZYUVSSSTVSUUTUTTTTUUTUUUTUVTVUWWVWWXWWUU\fgfea`\ZZXYXXWYYXXXXXXYYXXZYXYYZYYYVVVUWWW_muuqommifb__^\Z[ZZYYZ[[ZYZZZ\ZWYYYYX[[YXXYhstqnjdc_`]^\]\\\]\[\\]_]\_^^\__\]\[]]]\amsoha^\\YXXYZ[YZYXWXYXWYZZYYYXZYZZ[YYZZYY[gsvsqqqnmljjhhefcdddddcccacbecabcbb`ababcjqsqqnnlnkihiihgeegieed`_^]WVTXXTSTRRRQT[\VKEABA@@AA@@@A@A>?A?AA@@@AAB@ABAAA@@?@@DQYYWUSNNKIIHHIGGFGIGFGGGGFGGGGHGFGHFHIGKT\XVXWVTQOPNKJKJJLLIKJKJJKJKKKJJKJKJJJNTZ\ZWUVQPPKJHHHEGFIIHIHIHHGGHGGHHIM]rspol]Xn|ukaZQKEB?<<9877866653412320,,+++*+,+)*).4<<8/00244357776843100036778:<@GGFHFFIMJB@AGFGHEEFEAC@BFJGEECCEDEHGC@=?>@>===AHHIIIIIHHHHEDCCBCBCA@@?>A??@@@?BDEDC@<<=>@A??ACA>=;;645666456JLKKKKKKLLLKKLLKLKLLKLKLKLKLKLKLLLLKKLLLKLKLKLLKLLLLKLKLKLLLLLLLLLKLLLLLLLLLLLLLLMMNMLMMLMOONNNOOOQPOONOONNNNMONOMOOONMOONNNMONNOOONNOOOOOONOQUUUTSQPPNPOOOOOOOOOOPOPOPPQQPPQQQQQPPQPQPQPTWXWVSTRRRQPRPQPOQQRQRPQRQQQRRQQQRQSSSSSSSTVZZYWWTUTUUSUUUVUVUUUVUTUVUVTUUVUWUUUTVVXWW[ehfea^][XWXYXXYYXYYXYWXYW[YXYYWXXXXWUVXWXX`nuspnmmifc]][\]\ZYZYZZZ[YXXYYWWZZZYX[ZVVYZgrrqmjcb__]^[]][\\\][\Z[[\^[[[\[[\\ZZ\^Zbnsog`\[ZYXYYYYZYXXYYWVWZ\YYXYZYYZZZWZYZYZ[gsusrqpnmjikhgeeeeecfc``decaccd`acc`bbdbciqsqoonllkkigeghggffgdea^_^XVSVWVVURRSRU\[UMFCBBBAAA@AA@@@>?A>?@A@@@AB?AAA@A@@@A@FQZXVSRRNKIHHJHHHGJHFHGGFFGHHHGHEHHHFHGGKT[YXXWTSPONLMLLLLLKJJJKKIIIJKKJKJKKJJLLT[[XWVTRQNMIJGGGGGFGGJIIHIEHFHGHIIM`rsppm]Xo}ui^YPJEC=:99786775334532311**,-,++*++**18<:41/0145468869864321137788;<=>AEIHIIIIEHGFFEDCCECBCAA@@A@@?@@ABDC?><:9:9<=>>AA>=<<7757896657KKLJLKLKKKLLLKLLLMKLKLMLKLKKLKKKLLKLKKLLLLLLLLLLKLLLMLLLLKLLLLLLLLLLMLLLLLLLLLLLLMLLMMMMMNOOOOOOONPPPPONOOOMOOOOONOOOMNNOOOOOOOONONOOOOONNNONQTVTUQRQPONOOPONNOOPPOPPQQPPPRPPPPPQPRPQQPQRTXXWUVSSRQPRPPQQQQQQPPQQPQQRQPQQSRRRRSSSQSSVYYYWWTUTTTRUTSTUUTUTUTUTUVTTUVVWVVWTVWVWWV\ggfcb^\ZYXXXWXXXXXWVXWWXWXXXY[WVWWWWVWYXXZ`nuommmkgb_\YZ[\][Y[[Z[\WVUWWYVVZZZYXZYXXXZgttonida_`]]_\]\\]^\[XX\[\[XZZYY[\ZZ\][[anrnf^ZYY[ZZXWXXYXXWYYXZYYYZYZZYZ[YZZX\ZZ[\iquqqqnmmlhiggfeeeddcddcccebcdedbbecbddbdistrpmnllkkkighffgffefgfca_[XWTWWXTTSURX]\UMFDCBB@CCBA@AAA@@@?@@@@@@AAAAABBB@AA@AFQXWWSQPOLJGHIGHGDHGFFHHHHHHIJGGIFHFFGGHMWZ[WWURQQPOMLLKLLJLKLJKKKKLJJJJLKLKKJKKS\\YWWUQPMKIIIHIGGGFFIHIGFIIHIGHIHN`ttnpm]Xn|ti_ZRJEA?;;978765555543032/,**++++***)+.795201.03335878::8634125676:<==@<==>@DGIIIIHGGGGGEEDDEBDCCACDB??AA@AA@><:878766:;=A@<;<;8769<;8968LLLLLLKLKJLLKLKKLLKLLKLKLKLLKLKKLLLLLLLLLLKLLLLLKLLLLLLLLLKLLLLLLLLLLLLLLLLLLLLLMMMMMMLMMNOOONOOOOQQOQNOONOONOOMNNOOOMONONOOOOOOOOOOOOOOOOOMOPTUTTSRQPONOOQOONOOOOOQQRPPPQQQPPPQQPPPPQPPPSWWWUTTRRPQQPPQRQQQPRQPQRQQPPQQRQRRSSRSSSRSVXZXWVUUTSSSSSSUTTTSUUTTTTTUTTTUVUVVVWWWWWW]ffeda^[ZYYXXWXXZYXWWWXXWXXWWYXVXVXVVVXZYXX_prllkkhb_\\Z[Y[YYY[Z[[YVUUVYVSUYZXXWXYYZWZhrrpokcb`_^^_\\]\_\[ZXWYZZYZYZY[ZZZZZ[[Y`ksmg\ZWXYXXWXZXXYZXYZZWYY[XWYYXXX[[ZZ[[\Y^hrsqqqqpnkkhgggfedecedcdcadcadbda`bbd`c`djqsronmlkjjhghghhfhggfgfgcc^YZXYYXVVSRRX^]ULFCCBBAAAA@ABA@A@???@@@?AA@BA@AABBA@A@FSXXVUQONKIJIHHHIHIEFFIGHHIIHIGHHGHDFDHIMU\ZXWWUQROOLLLLLKKKKJKKKKLLKIKLJKKKLKJKT[ZYXWURQMKIIGEHHHHHFGHJGGHIHHHIIHQastopjZYo|ug_ZQJDA?;9997748546552121-))))**))*)(,-10/0./-/11356778:7744336578:;=CGHJIGIMOH>=<==?BBGIIIIGFEFHHEEDEECCBBEFFA?A@AA??<:7867554688<@=:;;8879;@>::99KKLKLLKLLLLKLKLLKKLKLLKLLLLLLLLLLKKLKLLLLLLLLLLLLLLLKLLKLLLLLLKKLKLLLLLLLLLLLLLLLMLLMNMNMMOOOONONOPPPPNNOMONONONONNOOOONOOOMNOOOMOONOOONNONOOPSURTSRPPOPPPOOOPPOPPPPRQPQQQPPOQPPOPQOPPPPQTWVVUTSRQQPQQPPQROQPQRQQQQPQQQQQRRRSRSRTRSRWXYYWUUTTTTSSTTUTVUVUSUVTTUUSUUTVUUVVWWVWVX[cgfca^][ZXWZXXXXXXXZVXXWWWXYXXYWVWTUVWXXYW_mrmlkiec`[Z]\WYYYXZ[\ZWUTWUTTQSUWWYWYZ[[Z\jrsplibb`^_^[[\Z^Z[\ZVWWYWZ\ZZ\[ZZZZ[ZXYbnrng]ZVWYYWVYYYXYZYXZY[Z[[ZXYXZWYZZZZ[]_[\hssqrqpmomkiigheffdeccccbceddebddbdbececcirrspolklkkiihhfgiigehhgeba]\YWVXXWSSUV[_\UOFDCCBBAA@AA@@ABBBAA?@?A@A@A??@@AAAA>AGSYXWTRPMJLIIJHIHHEGHHGGHGGJIHGHHGIEEGFGMV[YXXVURPONNMLLLKKLLIJLKKLJLKJJLJKKKKKKT[[ZWWTRQMKIIFFGIFHHHHHIIIHHKJHHJKSbtrookZXp|th_YQJC><<;865736544442221.+))*)*)())++1660.--.01535569:8787733677997;DFGIKIJOPG>=?ABBAA@A@@@ABAAABBBBCCEB?==>?>;<==ABAEIHIFHEFEFDEFDDDCEDCGHEABAAA?>=;56654432467=?<9;;:978=??;;::KKLLKLKKKLLLKLLLKKLLKLKLLKKLKLLKLLLLLLLJLLKLLKLLLLLLKLLLLLLKLKLLLLLLMLLLLLLLLLMMMMMNMMLNNLOOOOONNOOPPPOONONONONOONOONONONNNONOOOOOOOOONOOOOOOOSUTRRRQQOOPOOOOOOOPQPQOPPPQPOQQPPQOQQQQQPQPRVWWUUSRPRQRPQRQQQRQQQQPQQQQRRRSRSQSRSSSSRRTXXXWVVSSSSSSTSTUTSUUVUTUTUUVVVTTVUVVVVWVVW]dgeda_\YZXXYXWXWXWWXWWXVYYXYXWXWUWVXVWYYYV]lrqmmihb_]]Z[ZYUWZZYYXVTRQPPRRQSVXXZZX[YZ^fstqkidc_\]^]]]\_\\\YVUWZ[XZ[[\[][\\\ZXY`nrof]YYXWWWVWYXXYYYXYWXZ[YZZZYXXZYZZZ\ZZZ\hrtspooonmihhhfgefeddbdecdcdbcbdcccdbebadkqrssonokjjhjihghghfffgfee_]ZZWWXXVVVYY\_]TLDCCDABABA@A?@AAAA@@@@@AAAA@?AAABBA@@@IUZVVSSPNLJIHHGHGFFFHGFGHIIHFJHJIHIHFHIKLV[ZYXVTTROOMKMLKKKKKJKJJJJJKLKLLLJIJJLLS[][XWUSQNJIIHIIHHGGHHIHIIHIIIIFJKSduroqlY[q~{se\XOHD@<:9775855653232221.+)*++*+*(**+0<>3.-.00/153799:9;97225668987;BEGIKILPPH?@?AA@?AAABACACA>>>A>>;<=?BBCGHIHGGEEGFDECCEEBEEEHIE@@@??>><744533333458<=;9;;;89;>>=>=<=>@@B@A>@@@AACAA@>>>=>=<=>@CBCEEGDEGEFDEFBECECCCDHHHFB@??=>=:435221233559::::::;:99;;<;<<=LLLKKLKLLLLKLKKLKKKLKLLLKLLLLLKLLLLLLLLLKLLLLLLLLKLLLLLLKLLLKLLLLLLLLLLLLMLLMLLNMMLMMMMMNNONOONOONQOOOPOOOONOOOONONONPNOOONOOOOOOOOOONOOOOONORSVSTSRPPPOOPOOPPPQQPPPQPPPPPPQQOPPPQQPQPPPPSUVWTSSRPQPPQPQPQOPRQPPRQQPQQRQRRRRSRRSSSRSUWXWVWUUSSTTTSSTSSSSTSUTTSTVUTTTUTUVUVWVWXV\dedbb^ZZXXWXWWWXVWXWYXYWXYYVXWWVVWVWXYYZWX]ltroomiha^\ZWWYVRUVUTSRPOMNOOOOPPSXWYZY[XYhssokgec^\\]^^[][[[YWUVWYZ]\\][\Z\[\\[ZYclqne]ZWWWWXYXVXXWYXXYZZXYYXUXYXXWXZY[[ZZY[istpopmlnkjiihifeedceedbaadbbddabedcbaadejrtqonmmkkiihihhihffhgfefdbY\Z[Y[YZZ[ZWZ^[UMGCCCCCBBA@?A?@AA@AB@B@AABAAAA?@?@?B@@GVZWVSROLKIJIGFGHHFIHHHIHHGIGHFFIGHGGGGIMW\YXXVUSQOONNLMLLKLJKKKKLLKMMKLLKLLIJJLU[[XYWURQNKHIIIEFGGFEHHHFIIJKIIIGIRgvpmsiX]u{qe_XOHD@=;:665664434223430,*(**))*)((*+1991-,,-.//2667755733444579535?@@??>>@@?A@??@>>??>?<>>BCBDEEFFDEEFDEFECCDCDBDDFHD@??>=>98432221123478:;88::<9:;;;:9<<BB@?AAB@AB@A?AAAA@A@@?A@AJUZWVTRPLJJHIJGIIGHEHHEGGHFHFHHHHGHFFIHHNX[YWWWTRSOONMKLKJJJKJKKLKKJLNLMKKKLKKLPW[[YXVUSQLKHIJGHGFJFHHHIIHIIIHHIILVkupnrhX\w~ype]YOHE?<>857776443334332/-*+**(()))()+2:92.,+,-.03667633232257766664:BCFIJJMRQF???@????@@@??>>=>>>??=>=@ACABCDBCGFEGEFGDCDECCDADCC@?>><;::6322011123578:999;<;:998998;<><<<==?>>>?@?????>=>>>??=?>?AABCABDEDFGGHFEDEBAFBAAB@@A?>;:;66331110001256778989986778788;:9KKKKKKKLLLLLKKKLLKKKKJLLLLLKKKKLLLLLKLLLLLLLLKLKLLKLLLKLLLKKKLLMKLLLLLLLLLMLNMMMMLMNMLLMNMOONONOONPPPNPOOONOOPOONOONOOOOOOONOPOOOOOONOOOOOONOOSSTSROQOPOOPOPOOQPOOQPQQQPQPQPPQOPPQPRPQPPQSUSUSTRRPPRQQRPQQPPQPPRRQQRRRSSQRRSRRRRRSRRTVWWUVTTTTRSTSSSSRRTTTTSTUUTTUUVVUUTVVUWUTV[dfdba]ZXYWVWXWWWVWXWXYXWXWUUVVUXWWVXXYWVUT[musolhgc^[WUSRQPQQPPQRQONMNMPOQROQPQUXWZZ\jturniaa_][[YZ\ZXYXXTUTYXVX[[Z[^[[Z[ZZXZcpsof\YYWYWYWXYXWXVYWWZZZYZYYYXZWW[WXY[ZZZ]jtroommlmmkhhefeeefdcccdaacccedadbacdbdbfkurpooonkiijghhhghffggefggecd`bcdb^_[X[`d^TLDBBCAABAAADBA@AA@BBA@A@?AABB@??@??A@AKX[WUTSNLJHJJIIIGHGHFHFEGGIGGFHIGIIGGIHGPY\ZXWWUQPONLNLIKKLKJJJKKLLKKJKMLJKLKLMNW[[XXUTRONIIIHHIHIIIFHIHIJHIIIIIJLYktqnsfW_{~yod[VMGAA<:976675543333431/++**)*+*+***,6<72.,,,+,.0122100012045665434;@AEFIKNSND=;?AA??<;;;<>>?A???>===>>?>>>@>@@BACDAACDFGHGDDFDDEDA@@????<988763411110002356577876755677777:87KLLKKLJKKKKJKKLLLKLLKKKLLLLLKLLKLLKKKLKKLLLLLKLLLKLLLLLLLLLKLLLLLMLLLLLLLMMLNNNMMMMMMMMMLMOOONONOOPPQPOONPOOOONONOOOOONONOOOOOPOOOOONOONOPNOOOSTSRSQQPOPOOOPPPQPQPPQPPQPPPRQQPPQPPPQPPRQQPTUTTSSQQQRPPQQRQQRQQRQQQQRQQRRRRRRRRRSSRRSTWWWUTSTUSTSRSSSTUSSTSTTTUUUSUUTUVVVVUUUVWW[ceeb_\ZYWWXWWVWXXVXWXWXXVVVUUWUWXXZZXWWVRS[oupnjgc_`[WUUURPQONOQRNNNMLLNNPQQQQPTXVVWYitsokf`_^][ZZ[ZYYZWUVTXWSWW]ZY[\\\[\Z[ZZbnsnf[WYXWXWWWXYWXYXYZXWXZZXXWWXWY[YZYZXXW]hssqnomkmkjiieeedfededdbbdccbccadddcbcb`dlssrqlmlkkijhhgfffgefffefhfeeeeefb^^\ZZ`c]UJCCDCAA@@?B?>AA?>@A@@A?@AA@@ACAABBAABCLWYWTTQNLJIIIIHFFGHIIFGGIHGGGGGHIIHHHHGIQZ[YWXWVSQMMLLNLLJLJJKKJKJKJKIKMMKMKKKJPY][YXWTQNLJIJHHIFHIIHIHHIIHHJHHIIMYntnnreW`}~wna]VKEB@<::775454533332/1-,)((()**'(()*010.-+*,,*././100//21245651214<>ADFHJPSMC<9>@?><=:9;<>?>?>>>??>=<>=>>>?@AA@AAAAEEEEFGEFCECEB@>>>==;:665432111220012354666655423567657877LLLLLLLLLKLLLLLLKKKLLKKLLLMKLKLLKLLLLLLLLLLLLLLLLLLLLKKLKLLLLLLLLLLLLLLLMMNMLNMNNLNMMNNLNMOOONNOOOOPPQPPOOOOOOOPONOOOOOOOOOOPOOOOOOOOONOPPOOOPSTSURRQOOOOOOQQPPPPQQQQPQPQPQPQPPQPQRRPPQQQSSUTTRRQQPQQRRQQRRQQRORRRRSSTRSRSSTSSRRRSSSSVVVWTTTSRSRRTTUTTSUTSTUSSTUVUTUVTUVUWVUUWX[ceec_][XXVXWWVVWWWWYXWWVWUUWVUVXYWXWWVVVTV\nupmjfb`]ZXXWRTTPNNOQRONNLLMNOOQQRSSUWVWVZivtphe^_^\Z[YZYYWXVURUVXUVW\ZY\\\\\\ZYY[bppkd[UWVWVVVWWYYYXWXXWVWYZYYWXYXZYYXYYXXV]irsrqnmmljjhifffdfdbdecdddaddbcdddccecb`dlrrppolklkhiihegfghfeeggegdfgfghic^\[^^dd]SJFCCCAAAABAAAAA@BBAABCBABA?A@ABAAAA@@CLWYWVVQOMIKIGIHFFGHGIGHHIHHGGIIHGGHEEIIJRZ\XVXVURPNNLKKKKLKJKJLJJLJJLLMLLLJJJKKOW\ZXYXUQNMKIIJJHGKHIJJIJGIIJJIJKIM[puqosdVc}xmb[VLFA?<:868564544332233.+()+)*())++),0-+,*++,,*-.0./////0/124541006=>?DGGKPSMC;?>>=<;<;<;=?=?@?>>>>>==>><>?A@??@@@A@ACABDFIIGFEECBB?=>=;98654433111100003254545442221345656777LLLKKKLLKLLLLLKLLLLKMLLLLKLLLLMLKLLLLLLLLLLLLLLLMLMLLMLLLLLLLLLLLLLMLMLLLMNNNNNMNNNNMNMNNNONOONOOPPPPPOOPOOOOOPOPOOOOOOPOOOPOOOOOONOOOPOOOOPOPRUTSSRPQOQOQQQQQRRQRPPQPQQQPQPQPRRRQQQRQRQQRTUTUSRRQRQQQQRRRRQRRQRRRRRSPSRRSRSRSRSSSSSTVVVWTUSSSRSTSSTTUSTTUUTSUTTSUUTWUVVVUWWWWV[ceeb`][YWXXYYWWWXXUXXZXXWVWVVVWWXXWVVXXVST^ntqljgea]]ZXVUSTQOOPOOOOLMNMMPPQQRRRSVVVX[htrokf__]ZZYZ\XZZWTTVTWWTVXZZ[\\\\]\][[\dpqkeZWUVUVVWWXYXYXYXXYXWXZYZYYYYYYYXXZXZY]ittqqoonkjjihgffdeedeeddbdcececccbeddbbaflssoonklkkhhhhghghggeeegeeeiigighc`]]ccbd]TKECBBBBAABCAAAAABBBAAA@ACCBAABA@BBBA@CNWZXWTRONJJIHHJHGFIIIIIFHHIEFHHHGGHGJHHJSZYXXXTTRQOOLLKKKLJIKLKKKJLKLKLNMLJLJJJOY^ZYWWTRPLJIIJIHHJIIJKHJIJKIIIJJLM\pvnpteWd|wla\UKFBA<<877655545434441-)()*)(*))+))/750+***,*+-+../0/0000103311//5??@EHILRSMB;:?AA?==<:<<<<>==???<==>=>>>><=?>@>>??@>?@ABDEGGHGDCCCA@?>;<966654232210100002254634432100334556678LLLLKLLLLLLLLLLLMLLLKLLLMLLLLLLLKLKMLLLMLLLLLLLLLLLLLLLLLLLMLMLMLMLLMLLNMNNNMNMNNNNNONNNNNOOOOOOPOPQOQQROOOOPOOOOOOOOOOOOOOOPOOOOPOOOOPNPOOOPPRTRSSQRPPPQPQQQQQQQRQPQQQRQQRQQQQQQQQQQRQRRQTUUSSRSRRRQPQRQQQRQQRRRSSRRSQSSSRSRRSRTSSSUUWWTUVTSTRTSTTSTTVTUUTUVVTUTVWVWWVVWWWUVUW[bfcc`]ZYZXWWVWWXVXXXXWXWVWWWVVVTWWWWWXWVWW^nupjlieba^ZVUTRQQQQPPNNNJNLNQOQQRSRTTSTVVYituqjg`^][[XWZWXYUUVVVXYYXWYZYZ\[Z\\\\Z\forne[WRTUUUUVWYYYYXXXWYYW[ZYZYYZXYYYWXXWY^lusppoomlikihffeeedeeedcadcabe`bdbdddc`bgktsqnnnnlljhgihhhhfgefgfffghfhiggdb^_aaa`\RKDBABBAAAABAAB@B@@AB@ABAACBA@ABBA@??@BMXYWWUROMJIIIHFIIIHHEGJJIIHGIIHGIIHGFGIKR[ZYXWUTQPONNNMKLMLKLKJLJJLLLKKLKIKLKMKRZ][ZYWURPLLJIIHFHIIIKJJJJIIIJJIIJM^puqprdYf}vk`[ULGB?;<:85765644543341,*))*)()))*))066-()())+,++,,-.0/000010/00/06?@BGJKMSRJA:=@??><=<=<<=;<=<======<;<=<=<<>>>=>>?>??@ADDDFGGGFECBBAA?::876554222111000111236455433100023465567LLLLLMLLKLKLKKLLKLLLLLKLLLLLLKLKLLLLLLLLLMLLLMLLLLLLLMMLLLKLLLLLLLLMLMMMNNMNNMNNMNMNMNMNMNOONOOOOOPQPPQQPOOOPPOOONPPOPPOOOOPPOOOOOOOPOOPOOOPOPRTSSRRQPPPQOQRRQQQQRPRQRQQQQPQQQPRRRRQQRRRQQSTSSSSRQRRRQRRQRQQQRQRRQRSRTSSSRSRSSRRSSRSTUVVVTUSSSSSRSSTSTSTTTTUUTVUTUUVWUVUUVVVVVVYcdca^\YYXWWWVXVXWVWWVXYWWWVVUSTWVXWWWYWVWW^pvrmlihf_^ZVUTRQQQRONLNMLLMOORRSSSSTUUTVVYgssqjgb]Z\[XYZX[ZVUUUUWYWYYZXZ[Y\]Z[\Y[[cprnf]XUUVUSVVWWVWXXXXXYYXXYY[Y[[YXX[YXZ\Z_jstqroollljjfffeeeecdddecddebbdcdbddabcbdmsroonllkljhhihiijggfgfghhffhifhhjd_^_^^`[RKDDDCBAAAAAB@ABCBADAABC@BABDDBBA@BAA@BLXZWWTRPNLIIIIGHHIIIHJFHGHGEFIJHIHHIHFHJS[\ZXWUTROOMKKMKKLKJLKLJNKLLMLLNNNLKKMKSZ]\ZXXURPMMIJIIIIIIHJIIIIIIKJIJKKN`qvposdXg}vjaZUKFA><;96446647774413/+*()+)(()()()/62+))((*((***+-...////00000//8?@CIKLOTQI>:<@>=><<===<;;<<;;>>=<<;;<===;<=>>>>>>?>>?ADFDFHFHEBBCAA@>;98674322311//0/000132335534211/224246667LLLKLLLLLLLLLLLKLLLMLKMLLLLLLMLLLLLLMLLLLLLLLLMLLLLLLLLLMLLMLLLLLLLLLLMMMNMNNNMNNNMNNNNNNNOOPOOOOOPQQPPPPNOOPOPOOOOPOPPPNPOPOOOPPOOOOOOPPOPOOPRTSSRQQPQOQQPQQRQQQQQQQQQRQRQRPQRPRQPQRPRQQSTSTRSRRRRPRQPQRQQRQRQRRRSSRSRSSRRRQRRTSSSSTTVUTUSRRRTSRTSSSSTTSTTSVTTTVTUWTUUUUVVTXVW[cdca_[ZXXWXXVVXWXWVVVWVWWWUUUVVVUXWVXXWWWW^pusomligba]XUUTSQQPPMLOMMMMNPQRRTSQRQRTTWVessqlha\[YYXWZY\ZWWTUTZZZZZ^\ZZZ\\Z\ZZ[[bosmf_VVUWTVVXXXXXXZYWXWWXXYYYYYYXYYZYYY[X^lssrrpomlljgffeeeeebceddccdcdcecbcebbbbcflsronnmlkkighjhgehhggegfffhifhffijc`[ZZ\]ZRJDCBBAB@@ABBAAAAABBCABAAC@@ACAAA?A@@ADNY[XVURQMKIHFHHHHHFFFHHFGIGGHHIHHIHHHJGIR[[YYWUSSQNMLKLLKLKJLKKLLKKLLKJLLMKJLLKRY\[XXWSRPLJIIJHHIHIIIIIIIIIJJJJKLQaruopqcXh~{vi_YRLFA==977538655445325/-++*,*)(((((*041*))(()**)*++,--+,...///00-09?BEJJKOTNG<::=;<<<==>==;;:<=;;<<=<;:;;==;;<===><<=>>=CDGEFHGFEFDBA?A?;7:54301331000/0.-001223443320/0222356654KLLLLKLLLLLLLKLLLLLLLLLLLLLLLLLLLMLLLLLLLLKLLLLLLLMLLLLKLMLLLMLLMMMMMNMNMNNMMNNNNNLMMMNMMNOPONOPOOPPPPPQQPOPPPOPQOPOOPPOOPPOOOOPOOOPPOONOPOPPPQTRRRQQPQPRQQPQPPRQRRRQRQRQQQQQRQQQQQQQRRRPRSTTSSRRQRRQRQQQRPRRRSRRRRSSSRRRSTSSRRSSSSTTUUUTTTSSSTRRSRRRRTSTSTSUUUUUUTUVVVVVWVUVUWYadaa`ZYYWVWWXWXUVWVXWVWVVVTUUUVUVVVXWTXVVW`outqomkhcb^ZXXVTROQPQRWX[_ghnopuwuqpnlnkkhpurmigb`^ZVWWZZZ]XWZXXXZYZ\\Y[YZ\]ZZ\[Z[cormf[VUUWUSXXXYXYYYWWWYYX[ZYXYZYY[[XY[[YY^lsrqqnnmlkkigheeebeebdecbedcceceebbecaaafpssonnllkjhhhgigfeffegffihihghgihga_ZZ[^^YPHDBABBA@?@@BAA@@AABAAAABABAA@AAAAC@@@CNY[VVSTPMKIJGGIGGGHFGHEGGFIGFFIHHGHFGIFLS[[YXWVURROMMMLLKJKKKKKLLKKKLLJJMLLKKJLTZ][YXWVSOMKIJJIIIHIIIIIIIIKKIKJJKQ`trnrsaXg~|vh^YRJD?>;99866646534443410+,-,+++(*)(,451*,+)*)))**++-.-,+-,-./..//2;ABFIIJOTMB;8:<:<;<<=====<;<=<;<:::;:==<<;;<=;<<<=>>>?BEHFHIHGEAAB??@=9765310/1100100./0/01002342300-0122236656LKLLLLLKLKLLLLLLLMLLLLKLLLLLLLKMLLLLLLMLKLLLLLLLMLLLLLLMLMNLLLLMLLMLMMMMNNMMNONNNNNNNNNMNLPOOOOOPOPOQOOPQOPOOOOOPOPPOPPNQPOPOPOOOOPOPOPONPOOPPRRRSRQROQQRQPRQQPQRQQQPRPQQQQRRQQQRRRPPRPQPRSTSSSQRQQRRQQPQQQRQRRRRQSRRRSRSRRRSSSSSSRSSTTUTSSSSSSSTSRSTSSRSSUURTUSTTTTVVVVVVTVVVUYbcaa^\ZYXWWXVXWWWWUXUWWVVUVUUSSVWWXWWTVWXU^ovuronlheb_ZYXYUNR[cikkmmqu{|tj^^[WVUXYYXZVWXVWYY[\\[YYZ\[YYY\\Z[eprmg^WUUUVWYXYYXYYYYXWYYXZZYYZZYZZ[YVX[[Y^lsrrnpnmllhhihfefffafdcecccdbcdddccba``bhprqqolmlijihhghhgffeghgfhhhhfgfihb\^XSZ__YOGBBABABAAA@ABAAAAAA@AAAAAAAAAAAA@A@B?DPYZXUTQPOLIIHHJHFFHHEIIGGFFGIGGHIGHGHGFLSY[YWVUTRPNOMMLJJKJJJLMILLKKKJLLLLKLKJMUZ\[YXVURNLJJJJIIIHIIIIIIIIJLLKJIKQbstnssaYi~{uh]YSJE?;;;:7455666443321.-+,+)))))(()-530*-(((((()))))++*,-,,-.....1>;=;<<<=<;;::9:;=;<;::;;::;;==>?ACDFEIHHFECC@??<:65430//.00001111///00122331/01//001136656LLLLLMLMMLLLMLMMNMMMMMMLMMMLLLMLLMNNMMLLMMMMMMLLLMMMMLNMNMMMLNMMMMMMNNNNNNOOOOOONNOOOONOOOOOQPQQPQPRQRQPROPQQPQQPRQPRQQQPPQPQQOQPPOPPPQQQPOQQQTTSURSQSRRQRSRRQSQRRRRSRQRRRSRRSRSRQRRRQRQRSTTTTSSRSRQQRQSRRRQRRSRRRRRRSRSRSSSSSTSTSTTUUVVVVUTTTTTSTTTTUTTTUTVUTVVWUVTUUVVWVWVXWW[`dba`^YXYWXXWVWWWWVYVWWWVWUWVXVWVWVWWWUVVY^owurpokieb_\YXX\ajqnjggo}~n`[YXYZZXY[YXZXXYZ[\\[\^\\ZZX[[[Z\esqmg[VVTWWXXYYXXYXXXY[ZXXZXYYXZYZZZYXX[[Yamuttqonmmikjihfffegeefeedacefdddeedbbdcdgosspnmnlkjiihhhjghhifgffiihihjhhg_[ZYTY^_XQIDAAAAAA?@BBBBCBBBBABAABCBBBAAAAABA@AER[ZXVSRPMKJJHIJGGHFHHHHFGGHIIIIHGIHIIHHLU[\ZXWURRPPNNKLMKLKLMLLLMLLKKJMNLKKKLLNU\][ZYWVROMKLJJJJIIJIJIJJLIJKJILIJSeurousaYl{sh\XRJDA><;98677665655334.---,,)*)+*)*,.-,+++*)())**(((****+,+---./.1=AADHIJPOJB87:<=>;<=>>=>>==<=<::;:;;<;;;;99<988:<>>>@BDFIHIJJGHICB?=866432/0/./0101000/.//101110/00/-/001334557LMLMNMLLLMMLLNMMMLMMMLLMMMLLMLMLMLMMMNMLLMLMLMMMMMLLMMMNMMMMNNLMNNNMNNNNOONOOONNOOONONNOONOPQOPPQQOPPQPPQRPQQQPQQQPQPQQQQQQQPPPPPQPPQOQPOPPQPQSTSTRRRQRRRQRQQSRQSQSQQRRSRRRSRQRRRPRRSPPQQSTTTSSRRRRQQQQQQRRPSSRRSRRQSRRRRRSRRRRRRRSSTUVVUTTSTSTTUTUTSTSTUUTUVTUUUTVUVWVUVWWVWUV[ab```[ZXXWVWWWVWVWWWVVVWVYWVWWWWVWXXWXXXWV_nwuqpqliea^ZY]hmfddito^cd_\ZXWWWWWXYYWZ][Z\[Z[ZZZZZ[\]essnf]ZUVWWWXXVXUYWUWVYXWXXXWXWXYY[ZYXWXZYbnutrpoommkjiihffefeeecffcbeeedebbefdabecintsonmljkkjkjjkihhhhhhgighigiigf`Z\\TSZ_`YPHBBAAA@AAA@A@BBBAAAABBBA@@BBA@CBABAA@GP[[WWURPMLJJHIHIHHIGGGGFGIIHGIIIHHFHFHHMU\[YWWVSSRPMLLLKKKLKLKJKLKLLLKMMMJLMNMMU]^\ZWWUSPMKJIKIKIJHIIJJKKJKJJKIIMTfusotr_Ymzre^XQHC?<>:756687624454420+/1,*)*)()(*)()))**)()*)*+())*+)+++----.//2=ACFIHKRRLA85:==<;<>?@>??>==><:;;;<;=>:899::878:=>?AACIFJJJJGHGGB>;6554421/00...000100/0///0000/.0.////02234447LLLLLMLLLMLMLMMMMMLNLNMMNLLMLMMLMLMNMMMMLMMMMMLNMLMLMNLMNMNMMLMMNNMNNONONNOOOONOOOOOOOOONOPPOPPPPQOPQPQPPPPRRQQPQQQRQQQPPQPPQQPPQPQQPPQQPPQPQPSRTUSRTQRQQRQRRRRRRRRQQQQRSRRQRRSRRQRQPPQQQRTTUSSRRRRRPPPRQRRRRRRSRSSSRRSRRRSSSRSSSSRRSUWUUVTTTTRTSTTTTSSUTUTTTTUSVVVUVVUWWVWVVXV\abba`^ZYYWVVXWYVVWVVVVVWWXYVWWVVVUXVWXWWUV^pvtqpokhda[bmqoijy²}obb`]_]YXVVWVZ[Y]\YYZZZY[ZYZ[gsrmf^VVVVXWXXVUTWXYYWXXWWYWWYXYXZ[XYZXWZY`mutroponmlkiigfeegffeeeeacefcfddeeeeb`ccgnttooolmljikiijihihhgggihijhhhga[[]XUUY__YPHDC@@B?AA@AAAA@@@@@@BBABCBBABBACBAAAAFSYZXUSQQNKKJIIIIIJHHHEIGHGIIHIHIIHHIGHINU]ZZWXUTRQOONKKLLLLLLKKLLLMLKKMLLNMLMMOU]]\ZYWVSOLJKJJIJJIKJIIIKIKJJJKJILTiuqour^Ym~{re]YRJC@==:977776554464540,13-,,*)+)((()(()*))*****++)(+*)+),,--+-..3=ACFIHLSRNA67<=>===>A@@?====<=<;=;;=;;;;:987658:=>?AAGHJJJIHGIID@9744433200./.--.//011/./.--//....0/0//10123346MNNNNNNMNNNNMNNOMNMLNNNNNMNNNNNONMNNNNNNMMNNOMNONOMNNNNOOOONNNNOONNNOOOOOOOQPPOOPPPOOOPPOOPQQQRQQQRRQQQQQRQQRQRSQRRSRRRQRPQRRQRPRRQRQQRRRPQRQQSUUTUTSRRSRSSRRRSRSSSRSSSSSQRRSSTRRRSSRRQSRSUUUTTTTSRRSRRRRRSSTSSRSRSSSTRTSTSSTTTRSSUTVWWVUTVVUUUUVTTVUVUUUVVVVUWUWVWTVWWVVXVWVVV\acaa`[[XYWXXXXXYYXWVXVWVWXWWWWVXWXYWXXVUUW_qvtrrnmhgiq~rhb[ZY[[[ZZZ[YZ[[Y\\\ertoh]YVWWZVVXVUUYXWZXYZXXXYXWXZYYZ[ZYYXYYanvttoomomlkiijfgffdefffccfddddeecdbcecdfhrtssommnkkikhkihiihhffgfijjhddbZZ]^VRU]``YOGBBAABABABAAAAAB@CAAABBDCCABBAACAB@@AGT[ZWVWSQPMIIJIIIIHGFHGHHHFIHIIHIIIHJGHGNW[ZYYVVURPONMLLLLJLLLLLLLLMLMLKLNKKLKLOW]^\ZZWUQPMLJIKHHJIJHJKKIJLJJILKIKUivqows^Zn~zqe]YPIC@=;:76566778535563.-10//2/.,-,+***)*)))))(*(+))*,++-++---,,--5>?BHHGOVVOB98<>>>>>@BA@>>?=>>>?<<;<;=;;:;:87789<=>@BCGIKKFDDCFE@;9856433100/..-...00/0./..--.///00..///02233468MNMMMMMMMNNNNMNNMNMMMNMNMMNNOMOMMNNMOMNONNOMMNMNNNNNNOONNNNONLNNNONONOOOOOPOPOPOOPOPPPPOOPQQPQRQRQRRRQPQRPQRRSRSQQRQRRRQRRRRRPRQQQRRQQQRPQQRRRSUTVUUSSRTRRSSSSTRTSRRSRRRSSQQSSRSRRRSQRRRSSTTVSSTSSRRQQSRSSSSSTTTTSTSSSTUSSTTTRSTUSSSUTWVWVUUUSUTUUVUVUUUVUUUUUVVVWVUWVVVWWVVXWV\abba_]ZYYXXWWWYYWWWWWVWWWXXVXWWWWYXTWWVUXX`rvvsqqrpxľxi^ZYY[ZYZ\[Y\[^itvof^[XWWYWVVVVXWXXY[YXXXWXXYVW[ZYY\[ZYY\bmvuspqqomklkihgggfhfeeedfedeedccdcebdedbhptsronmmlkkjkkjhjiifhggiihid`][Y]]VSQTZ_^WPGCBBAAAA@AA@BBBBDCBBBBABAABCBBBDABBAAGTYYXVUSPMKJJIHJIIGGGIIIHJIGIHIIIIIJIFGHLX]\[XVWVSPNMMLKLLKLKLLLKLLMLMLLMMLKLMLMW^][ZYWSQPNLKIKIJIJHHIIIHKKJLKJJLMXjvpows^[p~yqe]XPFD@=;;9766876654455/-,/,.14331222.,.,+*(((((()*(()++)++,,-+-,-.6>BEIHJRYWOB99=>?>>?AA@??<>=>?=<9:;<=>=;;;;:977:<>>?@BEGKHBBA@BB?;8665331/0/.-,,-,.../../.,--..-./-..../02333678NMMMMOLMMMNMNNNNNNNNNNMLMNNNMNNNNNNNMNNNOONMMMOMNNMNNONOMNONOOONNONNOOOOOOOOOPOPOPOOOOOPOOPQRPQQQQQRRQQPRPQRRRRQQSRRRQSRQQQQRQPQSSRRRRQRQRQQRQSVVWUTSRRRSRRRSSRSRSSRSTSRSRRSSRRRSRRRRRRRRSUVUSRTTSRRRRRRRSTTSRSRSTSTTTSSTTSRRTSSTTTSVVUUWWVUUUVUUUUWVVVVUVUUVUVWVWWWVVWWVWVVVVV[abaa_]YYXYXWWWXWWVWXVWYWXWWXWYXWWWVXWVUWXW_rxwvx|þĿrd\XYYXZYZXX\htunf_YUTVWUWUVXWWYYYZZYXWXYXYYX[[YZ_\[YY\bovvsrqomnkkkhfhfdefdeedfeeecdcdeedeccdecjqtqsoolmkljjjkjhgfggiihihg^^]]ZX\XSPOQX^\XPGDCAA?A@AAAABA@BACBABBC@BCBBBABCABBBAHV[YYWTSRNKJJJJIIHIHEGGJIHGGIIIJIIHHIHEGMW\\ZYXUSRQOMLLKLLLMMLJKKILLMOMMMMLMLMNNX]][YXXTRPMJHKIJIJJJIJJJJJLHJKIJLNYlvoozs\Zr}ypd]XPGBA=<:88667766435460.*,+,-0/./1344110//+++*+)()()))*)*+,*,,-,*-8@BEIHJSYWOB:;=>@AA>@A@?=<>==@=9;9;;>?;;9:9:769:<>>??BDGIFDB@?BA?;:664411/.--+,*-+-./-/..-,------.-/.//0/1334897MMMMMMNMMMNNNNNNMNNONNNNNNMNNNNNNNNNNNNNNNNNNNNNNONNNNNONMMNNNOOONOOOOOOPOPOOOOPPOOPOOOOPPQQPQRQQQRRRQROQPRRQQRQRRRRRQRSRRRRQQRRRQRQRPQRRRPRQRSUVUUTSRSSRSSSRSSRTRRTRSSTSSRSTQRQRRRRRQRQRSTUTTSTSSRRRRRSRUSSSTSSSSTTSSSSTTTTTTSRSSSTUTVUVVUUUUVUVSUUUVVVVUUUUVUUUVVVUWVUVWWUVVV[aaa__]ZZWWVVYWWVWWWXWVWXXWVVWYVVWWWVVTTWVV`s|ľ{f[\WYZ\\Y[istlh_[VVWUVVTTVZVXYXYXYYWXYXX[XWXZZZZYYYZaouusqrommkjihhffgfgfeeddefeceeeeeeecccddhqsqpponmkkijjjfghhghhigffeZ\]]YWVTPNOPW_\WPHDC@C@BBAAAABBABCABABBDABDBCBACBCBBBCIUZYWWURNMKJIIJHHIHHIHIHHIIIHJJHGJIHIGHHNX[ZZYWUTRQOOMLKLMMLLLLLLKLLLMMMLLLMLLMOV^]\ZZXURPLKJJIIIIIKJKIJKIIIFJJJKNYmunpzs][rxnb\WOGB@>=::8866765344450-)**+,+**++,-/02333111/.,,*)*((***+,+,.--,.:>BEIHKTXVOA:;>A??@@?>@=<>=>>=<<:9:<>=<;9989669:;>>=>ABFIGDB???@?;775311/./-++*++*-------------,-../.../011367;8NMMMMMLMMNMMNNNNNNNMMNMNNMNNNNNMNNMMNONNNONNMNNNMNNNNNMNNNOOMONONOOOOOOOOPPPOOOOPOOOOPOOOORQQRQQQRQQRQQQQQQRPRRQRTQRQRQRRRPRQRRRRRRRRQQQQQRRQRTUVVTTRSRSSSSSRRRRSRRRRRRRRSSRQRRSQRRRRRRSRSTUSTTTSRRRRSRSTSSSTTSSTSTTSTTTTSTTTUTUTTSSUVUVUUUVVUUUUUVTTUUVUWVVUUUVVVVWVVWWWWVUTUVZ`bb`^][XXXWVWWXWWVVWWWXVUXXVXUWWXXWWTUUUUSaxżph^ZY[]huulf^ZWUVUXVUUVXVVVVXWXYXXYYXYXXVWZ[[Z[\\bmvvrqopnkkijhfgfgffefdecbeedddeeceebdcaeirsrpopnmlkjjikihghghhgfhh_[_[YWSQQPOPOW\]WOEDABBAAAAAAABDAAABC@BAAAAAAABBCCBBBBDGV\YXVTQOMLIJIFIGIIIHIJIIHGHHIIHGIJJIHGGOY\ZXXWWTRROONMLLLLLKMLLNKLMKKLKLLLNNMLMV]^[YXWWQOLLJHIIKIHKJKJIJIKKJJKJJP\nuoq}s]\ryla\WMHB>==<98666655555640,*****(())()*,+-./022333221.-,*+***++,,-,,/@@A@A?>==?=?>;;999<<=;:8777779:=??>?ACEIECA?=:=:886420/..-,,*****++,,,,-,,+-,+,---..--..0234787NNMNNNOMNNNMMNNMMNNNNMNNMMOMOMONNNNNONONNNNNMONNNNONMONONNNONNONOOOOOOPOPPOOOPOOOOPOOOPOOPQRQQRQQQQRRQQPPQPRRQQQQRRRRRQQQQQRQRQRRQPQQQQPRQRQQQSVUUTTSSSSRSRRSRRRRSRTSTRPRRTRRRQRRRQRRRRRRSSSTSSTTSRRQRRSSTTSTSTSTSRTTSTTRTTTTTTSUTUTTUVTUVVUUSUVUTUTWUVUVVVUTVUUUUTUVUWWVVUUVUW[ab_`^]XYWVVVVVVUVWVWVWXVWUWXWVWXWVXWUVUUV^rľ}rnj`^huvmg^YUWWYWVVTUVWYYVVWZZWX\YXWYWZYYYZYZ[Zapvsqqnmllljighhgfeeefeffddedecfgcdeecdcdhstrqpoonlmjjjhjifgihggijg]^_\XVQQPOPNNV\[UNGECABAAAAA@@BCBBBBBAB@CBBBABCBBABBBCFKW[YYWVRONMIJIHJHGIHHHIGHGJJHIHGHIGKGGHHOY][XXWWUQOPOLKJJLKMKKLLKMJMLLLKLLLJLMLOW^]ZZYWVQOLJKKJJIGJIHHKJKKKKJKKKKO\nuor}t^\tyk`\WOGB>==:96566665456550+**,+*)()(***+)+*(+,,/101111111.-,.-,+,+,,1<@CGHGNVXTN>7;@?@@AACA?==<=>><;::98:99:9766887::>?>>@ACCEB@@=;777664200..--,++**+*+,,-,,,+*+,++-,-----.-..234575NOOOONNNOOONOONNONOOOONONNONNOONOONOONOONOOONOOOPONNOONOONNONOOOOPQPPPPQPPPOPPPPPPPPQQRPQQQRQQRRQRSQRRRQSSRRSQTRQTRSRRRRSRSSSRRRRTRRSRRSRRRSSRUUVUTTTSRSSUTRSSSRTUTTSSTRRSSSSTRSSSTSRSRRRSUUTTTTSSRRSTTTTUUTTTTTUSTUVUUVVUUUUUTTSUTUWWWVVTVVVVVVWVUTVWVWVVVUWUUVVVVWWWWWWVVVVUVZ`cb`_\\YWVYXXUWVWWVXWVWXWYXXWYVWWWWWWVWXfzɸ{w|pputmd^ZXVWXUTTUXXVWWWWVWXYZZZXXYXW[YZZ[YZ\drvtrrqonmlkihhffggghegeffeefefffddcebbdflrssqnpomjjjkkjjjiihkiifhe^[\\XUPRQPOPPU][UMFBAACCB@ABBADBCABAABBABBACACDDBDBCBABJW]ZWWURPNIKJJIHJHHGHHIHIGIIIKIHIIIIIHIJPZ\ZYYVTSRPNNLLLLJKLKLLMLKKMNMKNLOMLLMLPY_^\XWVURQMMJKKJJIIIKJJKLLJKKJKJJO^qtmru\[t}xl_[WJEB?=;::8677656566641+**+*+))+)((),++)()*)*,++/..1235/2211/.++-6?@BGIJOWVRJ=8<@BABDBBB@>>?>>==:::8:99;:776689:9<=:;:88666655552.+*,*)+))++**))***+)(**(()**+-..32224520,,.8@ACFIHPWROE<9=BCBBCABB@??@?><<<::999::9:8679887=<<96566532/0..-----+****+++*+,*+*+++++----,-----./02245ONNMNNNNONONONNOONOOONNNONNNOOOOOONPOOOOOONOOOOOPOOOOPNOOOOOPOOPQPQPQOQQQPQPPRPQOPPQOQQPQPRSRRRRQRQRRSSSRRRRRRRRQRRRSSSTSRTTSRRSRRRRSRRSRSRSSSUVUUUVTTTSRTUTSTSSSTSRRRSTUTRSSSSSSSRSRSRRRSSUUVTTSQSSSSUUUVUUUTTTSTTUTUUTTUTUUUTUSVTUUUWVWVUWUVUUVUUUTWWWUVWUUVVWVWVWWVWWVVWUUUUYabbb^\YWWVWVUUVWYWVWWXWVXWXWVVYWY[WVVYhſɻ{vj]XXWVVVXXWWXXVVXWWVWYXXYZYZ[YZZYXXX[^frvuspqpnmljjhgfhhgfedeffeeeefedfdddedcaelrvsronklljkjiiihihihhfkhaZZXXURQQQPOOOV][TKED@A@@ACABDBBDCAABBACCAAEDBBCCDDBCBCDLX\ZXWVRNLKJJIGHIHGGJIIHIHIGIHIHHIGHIIIJQZ][YXWUTROOMNMMLLMLLMMLMLKMLMMKMMLKLKMP[^]\ZXWRTOMLJKIIKJJJKKMJKLLLLLLMLQarunvs\\tyl`[VLFA?;<:9766667775662.+)*+**)*+++**+**,+))****,)*)***,..-121/,+0;BBDGHKQURME:7=<<;;9::;;;::7667:78;>???@>=:89974544133//-.--,+****+*******)***+*+--,--,,---.-/01233NOONNNNOOOONONOOOOONOOOOOOOOONOOOOONOOOOOOOOOOOOONOPNOOOOOOOOPPPPQPPPQPOPPPQQQQQQPPPPPPPQPRRRRQQRRQRRRQSQRQRRQRRRRRSRRTSRRRSRRSRRSQSRRRRSTSSTTSVWUVTTTSSTTSSTRSTSRSRTTTRSRSRSTSRRRRRSRSRSTUUTUUUTTSUTTTUUUSUUUSTTUTTTVTUSTTTUUTUUUSUUTWVWVVUVSWTUUVUWVVWWVWUVVVVVTUUVWWWVVUWVTUZaba__[XXWWUVVVVVXVVWWXWWVVVWWWXWYXWWWcƾspdZWWVUVXXWUVWWZXWWVWWXZZZ[[ZZYYXZ[Z[]dtxurrrommmjjigjggfgfddeeeeecdeddeefcededkstrrqnnllkkjkiiiijjhiijd]YVVWUQQRPOOOOV][TJECAA@ABB@AABCCBCCDBABCBBBDCBCCBEDAABDLX\YYXTQNKLIJIIIHGGHHIIIIIIIIIJGJHJJIJIMT\\ZZXVWSSPOOOMMMLKLKLLKLMLLKMLLMLLLLLMQ[^]ZZYVTROLLKJJJIJKJJKJKLKKKLJLMLOaruovr[^wwj_[TMHB?=;:;988676567661-*()*+*)**),0420.,*)**((()()'))*)+*+,-..-*2=BAEHHLRUQMC:7=BBCABCDDDCA?><=<<;:;<;::=:866688:9;=>?<<;8667554230130----++******)+****)+)++)*+,+-,,,,-,-./.00122OOOOOOOONONOOOONNNONONNOONOONOOOOONOOOONONNOOOOPOONONOOOOOOOPPPPPOOPOQPOQQQOPPOPPQOQPPQRRPRRQRRRQRQRRSRRRQRRRRSSQRRRRSRRSRSRSRRRRRRRRRQSSSRSSSUUUUVTSTTSTSSTSTTSTRRSSRTSRRSSSRSRTRRRRRSSSTRUSTSUSTSTTTTURTTUTUUUTTUTVUUTUUUUUUTUSTUTVTWUUVUTUUUUUTTVVVTVWVVVUWVUWVVWVWVUWVVVUVVZ`aba_]ZXWVVUVVUWWWVVVXWWWTVWXXWXWXXX\uǶ{iib[WWVWVXXWWVVZVVWWWVZZ[Z[ZZZZYYYZY[[drwurqpponlkjigffgggfgcfdeceeedeceeeeeddfhruqqppnmlkmkijijijjiiihaZZVVTTRQRPOMOPX\ZTMGCABAABAAABCBBBCBBDDCCACBBBCCBCCBACDEMY\YXWVSONLIIJGIHJKIHHHGHIIJGIJHIIGJJIIKT[]ZZXXVTRQOMNKKLMKLMMLLKNMMLNLOMLMLLMLRZ^][ZYWTRONMJJLIKKJLJLLMKLLLJKMMJQctrn{pX^x}wj`\VMHD?>;;8:69666555551.*))*****)),3=?<83,*)))((((('()))*))*+-,,-2?CCGJJMUTQMC86=AABABDDEECA>>==<<=;<<;9::99579:99::;;<=:7666553320/10/-,,,*****)*))))*)*****+**+,*+++-+,-.-.0/0223ONOOOOOPOOONONOONNOOOONOPONOOOOOOOOOOOOOOOOOOPOOOPOOOOOQNOOPRPQQQRRQQPPQQQPQPQORPQQPQPQQQQRRRRRSRRRRRRSSRTSTQSQSSRRSRSSRSTSSRQRSRSSRRSRSRRTUSSUUUVUTTTTTTSTSSSVTTSSSRTSRRTTTRSRSSRRSTSTRSTUTUTUUTTRTVTUUVTTTTSUTTUTTTUUUUTUTUUTVUUUUUVVVUUUUVUVVUVTWTUVWVVVVWWWWVVVVVWVVWWVVWVX[aca__\\ZWVXVVWXVWWXWXXVWVVVVYWWXXYZZiʷxhbaYVVWXXWWWWWZWVWWWWYXYZ\\[\ZZZXZZY]etxtsssonmlijiifghhfeeegddfeeeedeeeefdddeltusqsooomjkkjjjihjjigjf_ZZXVVTSQQQOMOPY[YTMGCBABCACBAABCBBABBCDCCBBDCDCCCDDBBCBFOYZYYVVSPJJIIIIGJKKHHHIHFGIHIIIIHIJJJIHKT]^[ZXWVTQOONKMLLNMLLMLMMPNMMMMNMMMNLLMT\`][ZXXUUPMNKJKKKLJKJKLKKIIJLINNMTevso{pZ]x|xi_[TMHD@<::8:86456535640-***,*+**),.49<><5+('()*)((((())***)*,,-..6ABEIKIPUVPMA78=ABBCDDDGDC@=<<<==>>;;;899:8789:9789;78876655323110000--+-+*+)**))(**)()*))*****+**++++,,.-/./02112OOOOOPOOOOOOOOOONOOOOOPPPOPPOQOOOOOOOOOOPPOOOOOOPOQPOPOOOOPPQQPPQPPQQQQQPPPPPPQQQPRQPRPPQRRRSRSRRSSRSTSRSSRRSSRSRSSQTSSSSSTTSURSRSSSSSSSSTUSTTUVVVUVSUUTTTTUUTSTRUSSSTSSRSTRTSRSRSSSTSSTTRUUUTUVUTUUVVTUUUUUTUUVUVTVTUUUVVVVUWVUUUTUVWVWVUWVUVUWVVVTUUUVVWWWWWVWVVWWVUVWWUWWVWW[aca_]\YXWUWWVVXWWWWVYXWXWWYXYXWXZXX^xʹnfaa[WWZVWXVVVXXXXWWWWVXWYYY[[ZZY[ZY\eqwusrrpomklkhgghgggededeeegddeeeeeefccdclsutsrpnomkkijkjljjhjhe`[]^\YSSQPRQOOLPX^ZSMDCBBAACABCCCDCBACBCAACCCABCBCDGECDCDENZ\ZXWURPNLIIJJHJJIIJHIIIIJHIIIIIJIJFJJLT\^[[XXWSSPPPOMLMLLMNMMNONOOOOMLLMLLNLNT]_]Z[ZXUQOLNKLLKJKJIJLJKLKMLKLMLNSeuso|nX_x}vh^ZUMGB?=><89:9687766770-+*)+*)+'*,1<@<::4,*)(***())))+*,*+,*,--./9CDFIKLQWSPLA79>@BCDEEFGDB@><<<=<<=<;::87688898897866666565533211///.-,*,+****))*)((()*))****)***,*++,----/-011333NOOOOOOOONOOOOOOOOOOOOOOPNOPPPPOOOOOOOOOOOOOPQOOOOPOOOOOOOPPPPPQQPRQQQROPPQQQQQQPQRQRQQQQQRSRRRRRRSSSSSRSRRSRSRSTSSRSRRSSSSTSSSSSRRSSSSTSUTTSTUUWVUTUTUVSTVTUTTSTTSSSRTSSSSRTSSSTSSRSTTTSTTUTTUTRUUUUTUUTUTUUVTTUUVUVVTVVUUVVUWVUUUUUUVVUVVUVWVVUVVUVUUUWTXVWWWWVVWVUWVWWXWXWWW[adba_[YYWVVVXWXWWVWVXXVYXVXXYWVXWWYlοvbdfd\WVVUUVWVVWXWXVVYZYYYYZY[[\Z[YYZervussqonmmkjihggghgfddceeeeeeedfecdddcbfmtvqqppnmlmkkkjjkhgdhc]ZYZZ\TQPPQOOOMLOW]YTJEEDB@ABBCBABCACDAACCABCDACDCBBDCCBBBCNZ\[XWSROLKJIJJIIJJJIIIHIIGLKIIIIIIIIIKKU\\[ZYWVTQPQQMLNLMMLLNLMMLNMNOONMLMMOMNT^`^\]YWSQNNMLLKIKKKIJKLLMLLMKLLNOVgxsqnZay}ug^XTMIA?<=;<:9967776684-,+**))**(,,6GNMEB<9::8686866676/,++****,*)*5DMOONE4*)))))*)(()++***-0//.,4BDDGKLNXXTQK?:=;<<;:;9888776677977644344544531100/.-,-,,+,+*)))))(*)())()*+)*)*)***+*,---,..-0024433PPOOQPOPPPPPPPOPPPQOQPPPQQPPPPOPOQPOQPOOPQQPPQOOPPOQOQPPQQQQQQRRQPSPQRQRRQRRQPQSRRRRRRSRRQSSSSSTSTTRSUTRSSTTRSSTSUTTRSSSSSTTSTTSSSTUSVTUSUTVTUUVXWVWUWUUUVUUUTUSUTUTTUSTTSTTSSTSTSTTUUTUTTVVTVUUWVTUVVTVUUVUVUUUVUWVWVVUVVUVVUVWUVVVWWWWUWUWUVVWVWWVWXUVUWWXWWWXVWVVWXXVVVVVWWX\adb`_][XWWXVXVVWXWVWUWXWWVVWYXYWX_yʼfXbmk]UTWXWYVYXYXWXWVXZZ[Y[ZY\Z[\[^gvvvurqommmkkhgggfghegfeeeeeeeedeebddeedhnvtsqqqqnlllkkkkebZ]^ZWSSSRQONPRONOONNPX]XRLFCBCB@@ABBCABABDCBABCCCBCCBCBDDCDBBCFR[]YXUUQOLKIKIHFHIIJJIIJHJIIKJJHIJIJJKJMV^^[[ZXWWROQONONNNMMONMMOLMOOMNNMOMLNMNU_`^[YYXWQONMMJJKKJLLLJLKLMLLLLMLOYkzrtkY`{}sf][SKHD@?><899767776665/,**,*,+**+-17?ADFB1)++)*((()(**,,()4;<8..8EEDIKKPYYSRI?;@FJJJGIFIFBA??>=<<;8:88686765656663421131243311//-.,,,,+++)*)*))))))*)*****+*+*+*+*,---,..--00233434QPOPQPPPQOOOPQOPOPQOPPQPPPPQPPPNQOQOPQQPQPPPPPQPQPOPQOPOQQQRQRQQQQQQRQRPRRRQPRRQRQRRRQRQRQRTRTTSSRSSSRTSSUTRSUTUTRSUSTTUTUTSSTTTUSUSTUTVTUUVVTVWVWUVVUTUUTVUUSTUTUUTSSUTSSUTTTSUSTTTUUUTUSVWWVVUVUUWVUUUWUWVWUUVUVVVVVWVWUWVVVVVVWVTUWVVWWVVVVWVWWWWWUWWVVWXVWWVXVVVVVUWWVWXWWWZ`aba_]ZXWVWXXWWWYWVXWVWWUWWWYXWWZrʽ^R`nnZVVWWVVXXXYWVXWXXY\[YZ[ZZZZ[]ftwvttqpnnlkjgghgfeefeeeefefedccefbedegggovusqrpopmlkjlhc__YXZWRRQQPNNQPPOONMNMPY\YRLDCBC@BBBBB@?ACBCBBBCBCCBDDCDBDDDDABBEP\\ZXWUQNLJJIJLHHIIIHIKHKKJJJJIKIJKJKKJNX^^[[ZXWUSPPONMNNMMMOMNNLPPNNNOONOMNMNPV``^][ZXVSPOOOLLMJKIKLLKLMNMLLMMMOXlxuvjYa~}rf]YTKGC>==<988776877663.,*)+)*)+*)),-01374,,+***(*((())),+,9FG>00>IFEILLR[YUSI?;@FIIIJHHGDC@@?=;;:877866656444434323332111321/0..-,,,,,,+)**)**)(((()(*)*)+*++++*++++,---...01135445POPOOPPPOQPOPOPPPPPQPPPPPOPPOPPQPQOOOOQPOPPPPQOPPPPPOPOPQQQQQOPRRQPQQRQQQRPQRQQQSQRRSRQRRRTSUUSTURSSSSSSSSRURSRRRTSSSSRSRRSSTSSSSSUTUUUUUVTWUUTWXWVTUUTUTUTUUVTUUUTUTSSTSTTTSTRTTTUTSSTUTSTVUVUVVVUSVVTVUVUVVVVVUUTVUVUWUVVUVSVWWVVWVVWUVVWVVWUVXVVVVWWUVVWWWWVVXWUVVUVVVVUWVVW\`bc``[YXXWWWXWVWWVVXXWWWXXWWWVVYlɳ~YS^ol[TXYW[ZYXXWWXWYWYZ\Z[[ZZZZ\]gtxtstppommkkhgggedeeedddeeedcaedfeceedehnwtrrrponnlljkc_\[XVWWRPPOQOOOOOOMNNNNPX[YQICABA@@@BB@BCCBCDCBBCCBBCABCFDBCBCACCFP]]ZWVTQNMMJKJIGGHIIJIIGHIIIIIJJKJIIIKKPW^\[ZYWWUTRQONKMLKLNOOPNLMNMNOONNMLOOLPY^_^\[YXVRPNLMLMMKKKMLLLMNNMNKMNMPZnzsxgXb~|rd]ZSJGD?><<:98998866753/.,+,+*+***(*,.+--++++)*)(+*'))))++3@IH?/1CJFHJKNV\ZVQJ?;AFJJJIEEEC@??==<9:778664334332334312111/0110/0/-,,-,+,,+*+**+**)(**)))()****+,*+,+,,-,,-../001143334OOPOPOPOPOOOQOPPPOPPPPOPPPQOPPPPNPPPOPOOQQQPPQQOPOPOPQPPRRRQRRRQRQRPRRPRRQQRRROSRRPRQRRQQQRTSSSSSTSTSTTSSTSSSUSURRTTRTTTTSTSRSSTTSUUTUSUTTUTVSTWVWXVVUVUUVVTUTTSSTTSUSSSTSSTTSTUTTUVSSSSTSUUWWVVUTUVUTVUVVTTUUUUWVVUWXVVUWVVUVVWWUVWVVVWUVWVVVVWWVVVUVVVVVWXVWUWVVWUUWVUWWXWWVV[aca`^\XYXVTVUVWVWWWWWXWVXYYWUVVc¿ɨrUS[nhYWVVWWYXWXZZWYXZYZ]\[[XY[Z[guwurtqopomkijggggegeddbeeeeddeedbbccffffmvusspqplllmlh_ZZVXWWWUSQPROOOMPNNNLMMOZ]YQIFCCB@AAAA@BCBCBBBCBDCBDBBDCDDACACCBCHR\\ZYWURONKIKJIHIIIIHIKIGIJILJIIKKKIHJIPX]\[YZXXURSPPPNNOJMMNKNMNNNOKOMMNNNMOOQZ__^\ZZXWROMLMNLMKKKJKLMMMMKMLNNMP[p{tyhXd}re]ZTJGB?=<;<9987887566/*+***)+*+,-**,*,,*+,**)*)**))**+*+0AJKMA.7JIFIMLPY[YTQJ===;8:7776555333223333110110//0/.//,-,,,+****))(((())))())))*****,+,,+,+-,...///01322332PPQQQQOPQQQPOPPPQPPQQQPOPPPPPPOQQPRPPPPQQQQOPPPRQPPQQQQQQQQRRQRRQRSQRRRRRRRRRRQRQRRRRQRRRQSUUSTUTSSUTSUSTSSTUUTTSVTTTSTSSTSTTRTSSUTTVTVUVVVUUVUWWWWTUVUVVVVVVWVVUTSTTUTUSTUTTTTTSUTVTTUUTVUWXWVVVVWVVVWWVUVUWUVWWWVVVVVVVWUVVWVVUVWWVWWWVVWWVVVWWVWWWWVUVVWXVXWWWWWXWVWVVWVWUVX[baa``\ZZWWVVWVXVVWWWXUXXXXXWXW_{cQR[rhXWWVWYYYYZZZZ[\YZ[[[\YZ]\]juwvtsqooolkjlihefeeffedefdeffeffceffefehnusrrqnolnlkmd]YYWWVVWTRQPPPPNOMNNNLMKRZ]XQHCACAABBCAABABBABCBCACCBDDCBBCCCCDCBDGT[\ZXWUQONJIIJJJGHGIHIJJKJJJKLLJIKKJLJIPZ]]]ZZXXUQQOOOMLMNNLJMNNNOONMOOMNMMNNNQY``^\[ZXVSQNNMLMLMOLJLMNNNNOKNNNOQ]q|u{gWe|qc][SKFD@><;<9997:67986.-*+,***+,,,+(*++++*+++*+*+)*)*+++-7EJMPD3@PLHKMMT[[WTRH=:@EEEGECAA?>?==;;89875653332221201100100.0//-/..-,,,,**++***)()(((()(**)*+**+++,+,,,,---///0001233333QPQQPPRQQPPQQPQQOPQQPQPPQPOQQQQPPRQQQQRQRRRPQQQPQRQQQQRRRRRSRRRSSRRRRRRRSTRSRRSRRRSRRRRSSRUTSSTSTSSSUTTTUTTTTTTTTSSTSUTVUSTVUUTTVVVVVWUVUUVWVVVWXXWWWUWVWVVVVWUWUVTTUUUTUUUWUVUVUUVVVUUUVVVWXWVWXWWWXWWVWWVVWWXWVWXWWWWWUWWVWWXWWWWWWWWWWVVWWXWWWXWWXWWWWWWWWWYWXWWXVWVXXXXXXWWZacb`a\ZZXWVXXWXWXXWXXWXXWXXYVayɶWSVaqcVXYYYYYY[YZX[\ZY\[Z[\[[\\jwxvusqpppmkkiggfcefffgfggdegggedggefgegiouttsrpollmljc]YZYXVTURQPOONOONMONMMMLQ[^XQIGBBEBAABABCBBABBBCCCCBCBBCCBBACBABCBGT\[YYWUROOKIKLJJIJKKKHJKMLJLJJJJIIKJLIKPZ`^^ZXYXUQPPPOMMNNMLLMMNOMPNMPNNPMNNNMQZa__\ZZYWSPOOMMOMMNMKLLMMMNLNOMLOQ_s{wfYg{qc_\TLFA@<<;98898886764/,.+,**,*,-,-,+*)+-+**+-**++*)**+,-7HLNNB7ITJIMMPX][WSQH=:?CCDDBAA@>>>==<:899767433122110010100000/..-.-..,+,,)*++**))()*(()))()*),*,,+,,,,--,-...000001121433PPPQQPPQPPPQQQQQQPQPPQRQQQQQPPQPPPRQRPQQQQQPRRPQRQQQRRRRRRRRRRRSRSRRRRSSRRRRRRRRRQSSSSRQRRSUSRTTUSUTTUSTTSTUTVTUUUUUUTTUUTTUTUTUTUUWVVWWVWVVUUWXXWUWWVWWUWWWVWVWTTUUUTVUVUUTUUVUVVTUVUUUVUVWWVVVWWVXUVWWVWWXWWVVWWWWWWWWWXWWWXUWWWXVWVWWWWWWWWWVWXWWWWXWXWWXWXXXXXWWWXWWXWWXWWW\bc``^]ZZXWWVXVXXWXWYYWWXZYWXe|ʧjSUWfo]WYVXYWYZZ\\ZZ]W[\]\\ZZY^ixwuusrqqnljjjggegfdeefgfceffcefefefhgfehpwusrrpmllljfa[WYVVVSSROOOOOONMMNOPNMNRZ]YQJFDBBBBAAACDBABDCCBABCBBABBEDBBCCCDBCGS\[YWVTROMKKKJJJIJJHJIIJIIJLLJJJKJIIIILPZ]][ZZXVVRQPOONNMMLLMLNMNMNNLPPNNNNOPOQZa`^\ZYXVRPNNMMOMKLMLNNLLMNMPNOMPT`v|we[h{qd]YRMIA?<<=99898778754/.,,()++++*++++*),+,(+++*'(),+(,,+-5IPTK=8NRJIMNQY\YVRPE::?CCCAAA@>=<==<:98897654322321110000/00//...-,---,,+++++)***)()((()))()***,+,,,,,,-,-.-.///0/00222313QRPRQQRRRQRRRRRSQRRRRRRQQRPRRRRRQSRRRRRQRQRRRRQRRQRSRSSRSTRRSSSSSTTSSRSTTSTSTSUTSTSTSSRTURSVSTTTUVVTUUUUUVWVUWUVUVVTTUTUUVWWVVVWVXWWWVVWWWWWWWWXWXVXWWWWXVWXWWWWWVVWVVUWUUUWUXUWVVWWVWWVVWWXWWYWWWXXWVWXXWWVWWXVWYVXXVWXYXXWWWYXWVWXYYXXWXWWWWWXXWZYWWXXXWXWWXYYYXXYXWYXXYYXXWY\`cc`a^[ZYYYYYXYYWYXYXYXYZWXhǽĐ^SVYjhZUXXXZXYZZ[\Z]^[[Y]\\]\^lvyxvpsoqnllkjghgeeeeggffefggfhehggfgfefhpwvurqpmmmle`\XWVUTRPPOPQOQONNNNNPONOMT\]XQJEBCAABB@BABBAACBDBDDBBBBDCDCBBDDCACFJT\\[YWTQPNILKJJJKLKKIIJHIIKKKJKKJJIIIIKQZ]]\ZYYVVSPPPPOMKLOLMONNOMNNNOOOOMMPNPR[a`_^\ZYVSPONMONNMJKLNNNNNONOONNPQbwzvdZj{nb^YTMHC?>=:;:888998875/,+-))*,,,+,,,+))-,-+)*))())+*)++++8JROA3;NMIJOOS\[XVROD89?AAAAA@>>=<<<;:999:7743333212100000/.///.....--.,-,++*++*++**)))((*)(+***,+--,-,----././/00000031333QQQQRQRRPRRRRRQRRRRRRRPRRQRQRRQRRRQPSRRQQRQQRRQRQSSRRSRSTSSSSSTSTSSTSSTTSSUTTSSSSSSTSSRTSSTUSTRTTTVVUUVSSTUVUUUTUTVVVUVTVUUVUVVVXVWWVWVWWWWWXVVWWWVWWWWVWWXWXWUWVVTUWWVUUUUUWVWVUWVVVWUVXXWXWWXWWXWWVYWWXWYWXYWXWXXWXYXXXXYYXXXWXYYXXXWWXYWWXXXXXXWWWXWXXWWXXXYXXYYWXXXXXXXXXWW\abaa_][[XXWXXXYXXWWWXYZXWYeÿʹrTSV\haXWWXVZZYZZZ\Z[[YZ[\\]\]jwxvutrppomlkjfffegfgfhhffgehghgfgfdeghfjqtttsqolkhe^ZYUTRRRPPPOPOPPONMNNPNNONOT\^XPIFDACCABAABBBCDDBCCECCBABDCBACBDDBBFGKV[ZYXVSSOMKKLIKKJJJIJJJKJIKIJIJKKJLJIIJQ[^_\ZXZVURQOPONLOOMMLMNPONOOQOPOONNNNOS\a`_\[[XUSPONMLLMLNNNLNMOMNMNONOORbz|xaZl{nb_\TLIB?><;:;98:98787611/.*,,,++++,,+**-+,*,*)*)*+)*,,**,:JMG6.=KJIMOPV]ZYSSNA88>?@AA>??==<;;::88977555332123100/000/..///------,,,,*++*+++)*)**(()*)**++,+,,,,...---/-/000011333343QQRRQRPQRQQRRRRQRQQRQRRQRPQQRRRQQRQRQRRRRRSRRRRPSRSRSSTSSSSTSSSRSSTSSTSSSRSSTRTSSTTSSSSSTSSUTSUSTUVVUTUTTVUVVTUUVUTUUUUVVVUUVVVWWWWVWWWVVWVWWXXWWWWWWWWVWWWWVVWWUUVVVUVWUVVUWVVVWWUVUVWXVXXXWXWXXXXVWWYXXXWXWWWXWWWXWWWWXWXWXXXXWXXXYXXXWZXWXXXXXXWXWXXYXWWXWXYXYXWXXXXWXXWWVVW[bdba`][YXYXXXXYVVWVVYXWXYgzǒ`TXXakXWXXXZZXWY[Z[ZY[[\\Z\]_lvwwvtttonkkkjfeeeffgdehfgghggeefgfhgefggkmlmmmmlc``YVWTRRRPQQPRQOONOMMMNPNNMLOU\]XPIECBCCBCAABAADCBCBCDCBCCADDCDCBCCCDDDJV\\XWWTQOMLKKJIJJIIKIJIJKJLLJJKLJKKJKLJR\_^\ZZXWUSQPONMNMOONMNNPPNLOPOOOOOOOOPRZ`_^]ZZXVUPMNMLKMMMKMNMLLNMNOMPPPTd{}x_Ylzma_[QJFA?<<=;:::888667876641.10/,**(+(,),,**)***(())++**-.7AB=/0CLJINNPZ[ZWTRLA88>@?@?>=>>=<;<9:987864542332311100/00././.-.------,++,+****+))(**())))+*+*,+--------.////000001244443RRQQRQQRRRQQRRQRRQQRRQQRRRRRRQRRSSRRRRQRRRRQQRRRRRSRRRRSSSSRSSUSSTSTSSTUTTSTURSTSSTTTTTSTUSTRSTTTVUUVTUWUUTTWVUTVVUUUTVUVUUVUVUVXWWVVWWWXWWWVWWWXWXWWWWWWWXWWWWVVWWWVVWWVUVVVTWUVVUVWWWXWWVWWXWXVYWWWWWVXXXXWXXWVXYXXWVWXXWWWYXYYXWWXWWXXYZXXXXYXWXXWXWYXXWVXWVXXXXXWXXXXYWXVUUZbccb^]ZZXWXYXWXWVVVYYYXWcyþͶyVUVXgcXYYZYYZYZYYZZ[ZY\]\]]`lvwvussrnmjijiggfefgffefgfhhhgghgeffhffc_ejihjnli`\\WVUSQPQOOPPPOOOOOOMLNNNNNNOV]\WPJECBCBCBABDABCDDBBDDFABCACBCCDCABBDCDJW]\ZXWUPNNJKKKIHIIIKIJIJJKLJIKJKKHLJLKKS^_]][ZXVSSRQOOMNONMNNOONQPOOPOOOOPOPOPR]a_]\[[XWTQONNMLNNNMMNLNNONMNONPPUe}}y{^Xnzlb]ZRLEB@=::<;:999:967899;<99@A?830.-))++++,***()((+,,)+*07;64,5HJFKNNTZ[XVRRL?7:=??@>>==;:::76665444232122210000//.///..,-----,*++****+*+*+)()(()))+++++,-+,----.0//0000101335545QQQPRRQOQRPRPRQRQRQPQQSRRROSRRQRQQRPRSRRPRRQRRQRSRRRSSSTSRRSRSSSTSSSTSTSSSSTRSTTSSTRTSTTTSRTURTTSVTUUUTUUUWUSUTUUVVUTUUUUUUVVUWVVWWWWWWWWWWWXWWWXWWWWWWWWVWWVVVVXVVWVUUUVUWUVVTUUVUVUWWXWVWWXYWXWWWWVXVWWXXXWXXYWVXWWXWWWWXXWYWXWYWXXXXXWXWXWXWXXXWXYXWWWXXWXYXWXXYXXUXXXVXUXVUZadcc_][YXWWYWWXXWWWXVXX\uʝfXUS_jZXXYZZYZZZYZY\Z[\]\\\^lvxuttronljjihheeffddgggfffgghgggefffgb\]clgfhlhc]YYXSRRRPPOPQQPOOOOOOONOONONPPR][WOHEBBBBBBCACABBCDEBBCCBBAAACABDBCCCBBCJW]YYWWTPNMKJKJJKKJJJHJIIKKKLLJKKLKJIJKLT]^][ZZXWSRQPQNOOOOOMOOOLPONOQOOOOONOOOR]a`]\[YXVTPNMPNMMPOMNNNOPOOONPNNOWg~|x|[[pzj`][QLFC?>;:98:979:778899:;;>HTUSJB<4/.-+)*)**))(())++,*,2@D<0-;IIFKNRX][XVSRL>69<>?>?==>=>;:;:877666334323331000/./.../../..-------****)*+*()*))*(*))*+,++,++,,---..0000000124445545RRRSRRRQRSRQSRQQSTSSRRRRRRRRRSSRSQSRRRRRRRRSRSSSRTRRSSUUTUTSTTSTUTTTTSUTVTUUSTUTTTTTUUUTVVTUTUUSUSUVTVVVWVTVVWUVVUVVVWVVVWVUVXXWXWVXWWWXXXXVWXWWWXWXXXWXWXYXWXXXWWWVVWWWWWWVWWWWXWVXXXYXXXYXYWXWYXWXYXYXWXXXYXWWYXXWYXZYYYXYXXXXYXYXYYXXXYYXYXXXWXYYXYYWYXYYXXYYYXXYYXYYXXYUXWV[bdbd`][[\ZZZYYXWUWWVVWYl;aWY\fcXYYZYZZYZ[]]]\\]\]^]^mwwvtttrmjijghgfhgghfhggfhgifhhhggffhh\[\dihhkkd_\YXVTQPPOPPQPPPOQOMNNMNOOMOMNOV\]YOGFCBBBBCACAABBBBFDDABCCDCCCBBCDDDBCDFKY]ZZYWTSONMLMLKKJJLIJJIJIJJJJJLLKLJJKKJT^^^[ZZXWSRQRPOPPONNOLNNPNPOOPNOOPOOMOOR\`_]^\ZYVTQPMPPMMOONNONLOLMOOONOQVk~zz^\rzj`^ZRKGA?<><::;9998788:;;=><;DPTXZZVOFA:1,,*)+*+(*+**+,)-3??>>>==;<<:8877555445333321201000//0///..------,++*+**++****))()))*,**+,-,+,,,--0/00/1133233466466RRRRQRRRRRRSTRQSRRRRSRSRRSRRSRSSRRSRSRSSRRSRRRRSTSSTSUTTTSSUTSTVSSSUTUTUSTTSUUSUSTUUUTSTTTTTTTTTUTTTWVVVVUVVVWVVWUWVVVWWWVWXYVWWWWXWXXWXXWXXXWXWXXWWXXXXWXWXXWXWXVWWWWVWWXWVXVXWWWWWXYWXXYYXXXWXYYXWXXYXXXXXWVXXXYXYXXXXXXXXYXXYXXZYWYYXXXYXYXXYYXXXXXXXYXYYXXWXXYXXXXYYXYWVVXW[bfda_]Y\YYYWXXYXWWYWWW^x˫rVVZagZXY[\YXZYYZ]\Z[\]\^\_luxuusrnkhihfgjgihfgffgfggghhggghghgg`YZ[dihkje_\ZXWUSSPOPOOPOQOONMOOMNOOONNNMPW[\WNIEDCBACBDDAABBABFCCABCDEBBACACBDCCDDELZ][YXWUQOKLLLKKKLLKIJJJKKJIKJJJLJKIJJLMV[^^[[YZVSSRQPOPNMMMONNMNNNNOOMOOOONONOU]``^]]ZZVSPOONOOOLNMPONLMNOOPOOOPXl~|xv]\vxj_^XQJHA?><<;<;:7978798;;:<;;>AGJNTZ\[XSJB93/,+)*+***,+*-,/21-4EKHJMPV]ZYVSSPH;6:=?A?==>=<;:998775555334433221100/1//00.-./.-------++*++++**+*)*)**+***+*++,,,+-,--/00003124346556666QRRRRRRSQRSSRRRRRSQQRRQRRSRSQSRRSRRRSRTRRSRRRSSRSSTSTTSSSUTSTSTRSTUUTSTUTUTTUSSTTUTTVVUUUUTUUTSTUUTUVWVVWUUWVUWVVWUVWVVWTVWWVXWXWWYWWXXXWWXXXXXWWWXWXWXXXXVXXWXVVVWVXWVWWXWWWWWWWVXYXXXXYXWXXXXWYYYXYYXXXYYWZYYXYXWXXYYYYYYWXXWYXXWYYZXXYYYXXXXXXYWYYXYXYXXXXXVYWYXZXXZXXWXWVXV\bfdc`]\YXYYYWYWXVXYZZ^eÔcTU_i\YYYYYY[[\\]]\[\\\\\^mvxutsrmihhgeihghghhhhdeghhhhfhffgfdcZXWYchilg`\[XVVSOOQOPPPOPOOONNNNOONOONNPOQV\\VNJDBCBBCCDEAABBEADCCBCACBBCBABBCCCBDDCMY\[ZXWSPPMMJJLLLJJKJJJIJJJIKKIKLIJIKJKNV\^]ZZYXVTRRSPPNNOMMNNPOMOONOPOOOMOPQOQV^`_]^[ZYWSPPOMONNNNOOMMMNOONNPPOOZm{xr[]vvh`_XSKGA@?=;;;;:897:877:;::<<><>AEIMNTY[[ZVOH?72,++++*****+*-,6GHGKMTZ]\XVSRPG:59=>?>>>=;;<;:98776655444322221111001000//.////----,+,,*+**+)+**+*)(+*)*,*+,--+,,,,./00011345546556556RRRRRRRRSQRRRQRQRRRQRRRQSRSSSRSRSRSRSRSSSRRRSSSRTSTUTTTTSUSSTUTTUTUUTUSUTUSTUTUTUVTUTTUTUUSTTSVTSUUUVUWUVVVVVVVVUVWVVWVVXWWXWWWWWXXXYXXWWXXXWWWXWXWYWXXWWXXXWWWWVWVWWVWWUWWWWXWWXWWXWXXWXYWYWWYXYXXZXXYZZYXXWYYYYYXYYYYXWXYYXWYXZYYYYYXYXXXXXXYXYYXYXXXXXXWXWVXYXXXYXXXYXWWWVWV[cddda^[ZYWYYYWWWWY[YX\g˵yWVWg^YYXYYX][[Z[\\\\Z[[[_mvxutspnkghgehggggfgggfhfehfghghefde_TTWXahiga^[[XUSRRRRPPPPMONONNOMNNONOPNOOOOV]\VNJEDBABBAACBBBCBBCDDBABABDCADBDCBBABBDMY\ZZXWTROMKKKMLMIJIIJJIIILLJKKJKKKIKJJMV]^[ZYXWVURPOPPNOOMMNLMMONLOONOOOOOOOPQU_b_^]\[XUTRPNNNOMOONMOOMPMNONOPQQZo|zq[^x~vf_\YQIFD@?<<9:9:8:97799:;;::;;<<==?BCFLQUZ[\]WQK@:31,*)()),**0@?>==;<;:9988756653443332111010100//.-./--...-.,,++*++***+*)*)*+++),,)*+++++,--./01132234554566444SSRTSTSRSTRRRSSRRRSRRSRSRRTSRTTTSSTSSSSRTSRSTTSTSTTUSVTUTUUUUUTUUVSUUUUUUUUVTTTUUVUUUVTUTTUVUTTSTVTUVXVWWWVVWVVWWXWWVXVWWXXWWXWXXXWXWWXYYXWWXXXYXXXXXYYYYWXVXWVYWXXXVWXWWXVWXXXXYYXYYYXYYXXXXXZXYYXYYXXYXYXXXYXXYYYYXYYYZZZXYZZYYYYZYYXZYYYXYYXXXYZZXXWYXYYXXXXXYXXYZXYXXVVVVVW\defe`_\[XYYXXWXXXY[XY_zȖaUWfaYY[YXYYZ][[]\ZZYZ\^aoxwttsqmkgfgihfiggffffggffhefdhhcdab[VRSV]hfa\[ZXXRRPPRQQQQPLOPONNONNOOQOOOOONPW][VOGEEBABBBABBACCBBBCCBBCAACCBCCCCBBBCCCNZ\Z[ZWSRPLJMJKLIJIKKKIJJKLLKLLKLKLJLKMMW_`_\Z[XWVQQQPOONNLNNONOPNOOOOMPOOOOOQQW_b`^][ZYVTRQONPONMNNNPNNONPPQQQQT[o|zpZ_yvf`^XPIGD??<;;<;9;9898977989::;;:<;=<>?@CHNQSY[\\YTRF>71.++*+*1?FDHMT\]\YWURPOD779?=@?>=;;<;;998876665553333320110100/000/../.-.-------++++++)**+*+*+++*+++*++,,,---/01222355655345544STTRTSTSSTSSSURSSTSTSUSTSTTTUTTSSTTTTTSSSTTTTSUUTTUUVTVUUTUVUVUVUTVUUVVVUUWUVWVUWUVWVWWVVVUTUUUUUUVUUVWVWWWWWVXXVWWWXVXXXXXXXXYYWYXYYZYYYXYYYYXXXYYXXZYYXYXXWYXXXXWXXWWYWXXXXXXZXYXXZXXXZYYXXYXZZYZYYYXYZYZYZZZYZZYYYYYYZXY[YZZZZZYYZYZZZZYYZZYZZYYYYXZXYZYYYXXYYXYZYXYZWVWWXYX\efef`]\\\ZYWYXVWXYY[dw͵vVXhfYYZ[Z[XY]ZZ\[Y[[[[]bpwxvssrmmhhfghhghfggeghfgedddafb]^a^XTQRV^da^[ZXWUSRPQQQQQONNOPONOONOOOOPOOOQNPY^\VNHDEBBACDBDDCDCDCBDDBCCABDDDDDECCEBBBEOZ\[ZWUTROLLLIKJJKJKKJIKKJJJJLKKKKLKLJLNW___\[YXVTRROQPOMNMOMOONOOPPNONOOONPPPRX^c`^^\ZYUSPPOOQPMMMNOONOOOORPQQRR\qzyn[`z|tg_^WPLFD@>=;=<:;::88767788877::::;<==<=>@CEHKQST[ZZ[WTKD<51/,4ADEIPY\]\XVSRQNE76;@?>>=<<;;;;978777666533323322211121000/0//./..-------,,,,,+,+,,+++,*+**+*++,,+--..001234556656655333TSTTSSRTTSSSTRSSSSRSSSSTSSSTTSSUSRSTSTTSUSSSSTRSVUUVUUVTUUUVUVUUTWUSWTVUUUVUUVUWVUWTWVVUUTWVVWUUVVVUVVUVWWXWWWWWVWVWVWWYXXYXXXXXXXYYXXYXWYYWYXZYZYXXWYXYYZXWWWWWWWXXXXWXWWWXWXZYYYYYYZYXYYYYXZYZYYYZYYXZYZYXXZYZYYYZZYZYXYZYZZYZYYY[YZZYZYZXYZYWZZXZZYYYZYYYYXZXYYYYYYXXWWWWVVW\dgeeb^][YZYYWVYYWVX^uƓ_VheXX\[[[ZZ\Z[[Z\\[]]^bpxwusqpplkgihkhiefgghffhe`^^]^a]]\^ZUQOQV^b_\ZYXUSUQRSQPPQOOOOOLOOOOOPOOQONNPNPX^\WLHFDCDDDBCCBBCBDCCBBBCBCDDBCCBBAACCCCFP[][YWVSPOLLMLMKIJKJJJLJJLKKLLLKKLLJLKJNW_^^[Z[XVUSQQPPOOOMMONPPONOOOPONMPQPPPPW_a_^]\ZYUSRPPOOOPONPPOOOOPPOPQQSR^rzxp[ay}rd`^WOKFCA>=;:;;:;::9987789:78;:79:;:;;;==???ADFJLRUVZZZYUPF@9@NMLPW\][XYTSRPNB78=>=>=><;;::;998876665653334311121110000/0/././..----,--+,,+,,,++**++***+**+++,,--./000234565656554333SRTSSSTTUSTSTTSSTTSSRTTUTTUTSTTTTTSTUTTUUTTTUTTVVUVVUWWTVVVVVWVVVWUUWWVVVWUWVVUWUWWWWVUVVWVUUTWVVWUWVVWVXXWWWWXWWWWXWXYYYXXZYXYYXYXYZYYYYYXYYYYXXYYXYYYXXZXYXXXXXXXXXWWYXXXYXYYYXZZZXZZYYZZYY[ZZZZZZZZZZZ[YYZYZZYZZ[YZZZZZYZZY[Z[ZZZZZZZZZZZZY[Z[[YZXYZZ[YYYYYYYYYZZYYYYXWYXYWY]egfeb_]\ZYYYYXXYWXY_xβsXjd[Z[[Z]ZY]\[\[]]Z\]]amxwutqppojhjijihfghgghfeaZYWY\[[Z[XVSPPQW]^^[YWXVTTPRRPQPPOOPQOOOOOPQPOOPOOONPQY]\XNFFDBCCDBCCBABCCBDDDCCCCCDACCBABCCFDBFQ[_\YXXSOOMKNLLLKJLJJKJJILMKKLMMKKLLLKKOX^^][ZYZUVSQQQOPPONNPPOOOQOOOPPPOPPPMOPYa`_]\[[XXRRQQQPPOMPOONPPNNOOOOQRU`szynZa{|rc`^WPKFC?>=<<;;<99:::9779788998779:;:::<=<>==>@BDFJKQSVXZZ[XSW[YW[\\\[YVTSQOMB56=@?><=><<<;::88896666744333322322210/0/0///0/./..------,+--+-,-,,,+,+**+++,*-+,--/0/11234457766875443TUSSTTSSSTSTTRSSTTTTTTTSTTUUUTSTUSSUTSUSTUTUUVVTUUVTWVVWUWUVWUVUUVVVUWWVUVVVUVVVVVVWVVVVVVWVVWWUUVVVVVVVXVXWXXWXWXXXYYXYYYYXYZYXYXXYXXYYYXYXZYZZZXXYYZYYZYYYZZXYWXYYXXXYWWXWZZZZZYZY[YYYYYYYZYZZZYZZZYZYZZ[[YZZZZYZZYZZZYZZZZ[[ZY[[[ZZ[ZZ[ZZZZZZYYZY[ZXZZ[XZYYXYXYX[YXYWXXYXXWX]effdc`][ZYYYZXYZXWXZuōbld\ZZZZZ\\Z^Z\\[^[Z^]aowwurqppmkijhigjggggfdgb\TSSSVXWTWTQPQPRT[\[ZYXTVVSRRRQRQPPONOONOOOOOPPRPPPOPOQY^\WNIGDBCCCCCBCCBCCBDDDDCDBBCBCDDCBEDFCBGT[^]ZZVTQONKLKLKKKJJJLKIKJKMKJLLLKKLLLLOY`_][[YWWUTROQPPPPPLOPMOOPOOOQRRPPQOOPPZba__^\ZYUTPQPPOPNOOOPNPPOPONOQQRU`tyyoZb|}rc_]VOJFBAA=<;;;<<9:999788:899979879;9:::<===><;=>>BCDGLORUXYZ\\]\\\[ZZZVTSRPK@68=>=<;;;:988866655445334222311121000/0/.///-------.---,,-,+-+-,,+*+*+*,,,+-/.//022234676768::8665TSSTSUSTTTTTTTSTUSTTTTTTTTSTTTTUSTTTRSSTSSTUUUUVVVUWVUUUVVVWVWVUVUWVWVWVUVVWVVWUWVWVVUVVVVUWUUVWWVVVVVWWVWXWWWWXWWWYXXYXWXWYYYYXXXXZYYYYYZXYYXZZZYYXZZXZXYYZZZYZYXXYWYXXXXYYXYYYZYZYZYYZYZZZZYYZ[ZZY[YYZZYZY[ZZYZYYZZYZZZZZYZ[ZYZYZZZZ[ZZZZZZ[ZYZZZZYZZZZYXYYXXXXYZYZXXWWWWWXYY]ehgec^][\ZXYYZ[XYZY]ƾͫtm]YWXWY[]Z[\Y[][\\\^^bqwwtrponjlmjjiggihgghhg_VPRQRTSTSRQOONPNS]^\ZZWTVTRRQQQPPPRPPPOOOQONPOOPOOOOONPY]\VMHEDCCABBDACCBDDCDDBEDCABDBACDCDEDCBDHS]^Z[ZWSQOMKKKLJKJJJLKKKJJJLKKKKMLKKKLLP[__^\\ZXWVSRQRQOONOPOOOOONPNOQQPOOPPOOQZab^`]][ZVURPPOOOOOOPOPOOOQPPQPRQVav|yzn[b{{qd_^VOJFBA?==>;:=<;998;:;8879:9788698789;=<:>=<<>====>@?CFKNPQUWZZZ[YYYVTSQQPI<5:>??>>===<<;9:;9898666563433334322222100001///./-/---.-/-,,---,-+,,--+++++++,----.//01124578999:;;7877SUTUSTSTSTSUTTTTTSTSTSTUUUSTTSSTTUTTTUSVUUSUUUUVVUWWUVUVUUVVUUVUVVUVUVVVWVVVWUVWWUVVWVVWVVUVVWWVVVUWVVWWVXWXWWWWXXXXYYYXYYYYXYYYXWYZXYYXXZXYZXXXYYZYXYXYZYZYYYYWYWWWWXXXWYYYYZYZZYZZYZXZZYYZZZYZYZZZY[ZZZ[[[YZYYZZYZXZYYZZZZZZYYZZZZZZZZZZY[ZZZZYZ[Y[ZZYZZYZYXYYZZZXXXXVWVWXWVX]dgfed_][[YYXXYXXZY[bɻ¼iXWYYY[\\]Z[^\]^\^]^_cowvtqponkkjjjhhihhgggfc\UPPOPRQPQQONMMOMT\]ZZXVUUTRRRRQOPPOQQPPOPROOOOQOOONNOORZ^\UNHDDDCCCCDDDDCAACDDDDDCDEABCCCDFEECCDFR[[[YXWUQOOMLKKKKJKKKJIIKKKKMJJLKJJJKLLQ[__^\ZYZXXUSQPQPNOMONPPPOOQOOOQPPPPPOQS[aa`_]][ZVUQPRPPONPOOOPOOOOOOPRQSWbv|y{n[c}}pb_]WOIHBA@=>><<<<;:9:9:888788768878:79:;:<>;;;;;<=<<;==>>BEGIMPSTVWZWWUTRRPPI;48>@@??>=<<;;;:9;8986665444453333331011100000///.0//--------,,,,,,,+,,,+,*+,++--..00102334779889<<;:987TTUSSTUTUUSSTSTTRTTVSUUTSTTTTUUTSTTTUTTUTUUVVUTUVUWUVVVVVWVWWVVWWWUVWWUWVWWWWVWWVWVUVUVWVVWWWVVVWUUUWVWWVXWWWXXWXXXYXYZYYXYZYYZYZZXYYZYXZYYZXYZZYYY[YYZZZZYZYZZYXYYYYYXYYYYYYXZYZ[YZYZZZZYYZZZ[Y[[ZZZZYYZYZ\ZYZ[[Z[YZZZZZYZZZYZ[ZZ[Y[ZZZZZZZZ[ZYYZYZZZZYZYXYZYX[XZZYZXWYXWXXYXX^fhgec`]\YYYYZXYYXZYiʙgZY[YZ\\\[\[^\[]]^\[\cpvtrroommiijiggihghiec`]PRPOOPQPPOMMLMNNTZ]ZYYXUVTRSRRQPOPOQPNQOOPOOPPOOOOOOONQ[_[UNHEDDCDCBCBCBBBCCABCDDBDCBBBCBEFCEDDCHT]\[ZWVSRPMLKKKLKKLKJKKJJKKIJMKLLKKLLLKQ[`_]][[YWVTSROPQPNMLNONOPPOPOOPOQQPMNOS[bb`_]]ZYVTRQQOOOPOOOOOOOPOPPPRRTWcw}x{n[d}|oc^\VMJGB?>?=>=<;::;9:9:78:9;8988887887;<8::::;=;<;;=;=;<<<=AADHKMOQRRRRQPOPOJ;4:?@?@>=><=;;;;<:9976666544445332322122110000000///.---/...,--,--,,-,,,+,+++,,--/00010223597:9:<===;886UTUTUVTTTTUTVVUTUTTTUTSVUUVTSUUSUUTUVUVTUUUVVUWVWWWVWVWWWWVVWVWWWVWWWWVWVWWVWWWWWWWWWWWWVWWWWWWWWVWVXWWWVWXXXXXYXXZZZYZYYZYZZZZZZZYZZYZYYZZYYZYZZZZYZZ[YZ[ZZZZ[XYYZXYYYYYYZ[ZYZYZZZZY[[Z[ZY[ZZZZZZZZZ[[ZZZZ[[ZZ[[[Z[Z\[[[[ZZ[[[[[Z[ZZ[[[Z\Z[Z\ZZZZZ[Z[\ZZZYZYY[\YYXXZYXYYYXXXYX^ejhfd_]\ZY[[XXWXVY]rĽʜcXXXYYZY\[\]]]\\^\[Z\`ovtqropolihghgggggihe_`ZROOOPOOONONNNMLMT[][ZXWVVUUTSPRQQPQPQPNOOOOOOPOOOQQPOQSZ^]TMIFDDCBCCDBCDDDCCCBEDDCBCECBBDBCDDEDDJT^][YXVSQNNLKKLLKLKKKLMLLKLKLLKLKLNNLJMQ[`_][[[YXVSRRQPOOPOLOPNOOPQQPOPQPOPORPT\db`^]][[VURSQQPPPQPNLLLOPQQQRRVWZev}v{mZc}|ob_^ULJFB@@>><=<<;;9;::8889:;99777678;69998:::;79<:;;;:<==;;<==?CDEIIKLLLMLMME967??>@>==>><<<;;;;97877665646543333323221011100/00///.../.---.---,--,,,---,--,-.///011446667::<>><;;:77TVTTUVUVVUUTWUUUVUUVVUUVUUUUVVTUUUVUVTVVUUVWWWWVXWXVWWWXWXWWWWWXWWVWWXWWWVXXWXVXWWXVWWXWWVWWVXXWWWWXXWWWXWXWWXYYZZYZYYZZZZZYZY[XZZZZYYZYZ[[ZZZZZZZZ[ZZZ[[YZY[ZZYYZXYXZYZY[ZZZZZ[[[Z[[\[Z[Z[[[[[Z[[\[Z[[Z[[[[ZZ[\[[Z[[[Z[[[ZZ\\[[\[\Z[ZZ[[[[\Z[[[Z\[[[Z[[[[Z[[Y[YYZY[[ZYXYXXYZXY^figfe`_][Y[\ZXXYWZd¿ʔ`WYXXYZZ[\Z\\]]\]]\\]anwwqpmmnlfihgghgiiijd`bZRPOPNNMNNONMMLNLS[\ZYYWWWVTRRQRQQQRPQPPOOOPPPOQPPPQQPPU[`[UNHEECDCDDCDDDCDDCAFDDDCDBDCBBDCDDBCDDHT]\[XWVSQONKLLLKKLKJMLKLLLLJLKLLKLMLLKNTZ`_^\\[YWUURQQPPOOPOPPONNPQPPROQPOPQQOU]cb`^]\ZYWURRQROQPPONIBEIMQPOSY_bdkv{v{n]e{ob`\UNJGB@?<@><==;;;<;;:9::;9:8768796:9778799::778:::;8;9;:;;:;<<>?ABCDEFHHIIB93:?A@?>>>====;;;;::998766665555444333332210110000/000/..///.-,---,,,,--,--,-,--/.//1134466799:=>>>=<;:8WUVVVVUWVVVUUVWTVUUWVVVWVWVUVUVVVVUWVWWUVVVWVWWWWWWXXXWXWWWXXWXWXVXWXXXWWWWWWXWWWXWWXXWXXXWXWXVXWXXXWWWWWWWXYYXZYZZZY[[ZZ[Z[[YZ[ZZ[[ZZ[Z\Z[ZYZZZ[Z[\[ZZZ[\\ZYYZZZ[YYZZ\Z[[[\[ZZ\[[[\[\[[[\\[Z[\]Z\[[[][[\[Z[[[[Z[\[\[[\\\\]Z]\Z][[\\[]][\\\\[\]\\[[\Z[\[\ZZ][Z\Z[[[[[XYYXYYYYYW_hjigeb^\\ZZYXYYXX]n˖eZ\[Z[[ZZ\[]^]]\\[]]]anwsqolnmkhhghfejjkifd``YSPPPOOMOMOMLNMMLTZ\[[XWWVTUUQQRRQQQQPPPPPOOPOQPOPQOQPOU[^ZUMGEDEDBDDCCCBDCCBCE@CCCDDDCCACEDEFDCDJT]\[XXVSPMLLKKLLLKMLKJLKLLJJLJKKLLMMMMLT\``^\[ZZXVUTQQPPMOOOPNMOOPQQOPPQQQPPOPU]bb`^^\[XWUSTRQQPORRNHC>=BFFDKZcijnostzo^e~{oa^\UOKFC@??<<;<;9;;;::9:::979:99:98898878:97977898;;9:;:;;;<<<==>?BBC=84:=@A>>>>===<=<<;:899777766654554333331020110101/0000/0//.00./,-,,,--,-,--/---./00132346767;;<>???<<;98VTVWUVUUUUVVWVVVWVUTUWVUUWVVVWUVTWVVVVVWVUWWWXWXWWXXWWWWXWXXWXWWWWWXWWXWWWXWXWXXWXXVWXXYXYXXYWXWWWVWXXXWYXXWWYZZZ[ZZZZZZZZ[YZY[[ZZZY\ZY\Z[Z[ZZZZZ[[Z\[[ZZ[YZZZZYYZZZYZ[Z\[Z\Z\[ZZ[[[Z[Z[Z[[[\[\[\\[\[Z[[\\[\\Z][[[[Z[\\\\][\\[][[\\\[\\\][[\Z[\Z[\\[\Z\[[[\ZZ[YYY[Z[ZX[YXXYYZXYahjhgeb^\[\YYZZXXX_xĺľΟdWZ[[YYX\\Z\\[[]^\^]]bowsqmkmkjffjgffjiiggb_a[UQQONOMMMONNMNLMU\][ZZWWURSRTRRRPQPPOPOPROPQQQPPPRPPPOU\^ZULDECDCCDCCBCBDBCBDBBEBDCCCDCCCCHCDECDJU]\[YXWSPMNLLLKIKKNKNLLKJKLMNJKLLLKLLNMS]`_^][ZYYTTTRQPPONORNOOOPQQQQQPQQQPPOOV^eb_]_]]ZVTSQQQQQQQQNLG@=??==;<==<<=<<>;;;;;::9:9887797788957677796777678:8:9:;;9999887679;::957>=>>===;;;;;:;;:778876554433332332331022101/00/00.00//.---.-.,.,---.-.--//0002324579:<<=>?@===::6UWUSVVVVVVTVTVUWUVVWUUUUVVVVUUWVVUWUVWVWVWWWWWWWWWXWXWXWWWWXWWVXWXXWWXXWWXXWXXWXWWWXYWXWXYXXXXVWWXXXYWXXWXWWWXYYY[YZ[[ZY[[Z[Z[ZZZZ[Z[ZZZ[Z[[Z\[ZZZ[[[[XZ[ZZ[ZYYZ[Y[ZZZZZZ\[[Z[Z[[[Z\\[\Z[[\[[][Z\[\[\\[Z\[[[[[[[[\[[\[[\[\[[\][[[\\[\\[]\[[\\[[[[\\\\[[[Z\[Z\[YY[[Y[ZYYZZXYZYYZ^gkjgea_][Z[ZZ[YYYcȼƿüЮoXWYYWWZ][Z\\\\Z[^^\\`psrpijjkkigihgghhjfha_aZTPPPMMNMMNNOMMLLT[\ZYYXXVSSRRRQQQPQPPPPQPQPPQPOQQOOOQRU]_[TMHDCDDCDCBACDDBCCCDEBCEBCCCBCDDECDFDEJV]]ZXXVRQPMLLJKJJJKILKLLLLLLMJNMLLLLMMOT\a_^]\ZZXWRRQQQQQNONNNNNOOQQQQPQQQQQQQU_ea_`]]\YWUTQORSRQQPQOJDAA>;79=;===<=<<=<<::;;;:9999788898769777765667746875568;::7889744435555744<@??@>>>>====<<<;9;;98777566545443343232321221000000/./0/0/..-,-,-,,,-----.././0223544788:;<=?@@?<<987VUUVUUVUUVUVVUUVUVVVWVVWWVUVUVUWVVUVWVWVWWWXWWWXWWXXXXXWXXWWWYWWWWWWXXWWXWWXWWWWWWXWXXWXXWWXZXXXXXXYXXVXXWXXXWYZYZZZZZZZ[YZZYYZ[ZZZ[ZY[[Z[[\YZZZ[[ZZY[ZZYZZ[YYZYYZZZY[Z[[[[Z[[[[[[Z\[\Z[[\Z[[[[\[[[\[\\\[[\\[\\\[\[[\[\\Z\Z]\\\[\\[][][\\[\\Z\[[[[\[[[[Z[Y\[Y[[ZZY[YYZZZYYYZZYZ^gkhgga^^^ZZZ[[\ZXjŷ¿ÏbWZ\ZZ\[[Z\\\]]]]\]Zaqrroljijkhjkigighhhgabb^VQOONMOMJLMOLMONU]]\[\ZWUSRURQRQQQQQQQQQPQPQQRPPOPPRPQT\_ZTLFDEDCBCDBDDBDBBDDEDCBCDCDDDECBGDEEEEKW]\ZZWVSNONMLLKJKKKLKKLLLLLKJKMMMMLMLKNV^`^^]]ZXWVTTRPQPOQPONNNOPPQOPQPRRPPQRTW_ec`_^][ZVUSRQQSRQRQRPHEFFC<7798;AKVbgjlmnoptz~zm`_[QMIEBAA@>=>==>===;;;;::;;;989:8666:87768869575576547668767886874535532132325<@@@@??>>>>==<;;;:;9;:9987656554443333333323111/00/0000000/...---,,---.-.-....00233555577;;<>@AA==;966WWWWWUVWWWWVWVVWVWVVWVVVVWWVVWWWWWWWWWXWXWXWXYYYYXXXXXYWWXYXXWYYXXXXYXXYXXXXYXYYYXXYXYXYYYYYYYZYYZXYZZXYYZWYYYYZ[\Z[[[[[[\[[\\[Z[[[[\[[[Z\Y[[[[\\[Z\\\Z[ZYZZ[ZZ[[\[Z\[[[\\][\[]]]\]\[]\\]\[\]\]\\]]\\]\]]][]\\\\\[\]\\\]^]\\^[\]\[]\\\]]\\[][\\[[\\\\[][[]\\\[Z[[Z[[[YYZYYYXZ[Yahkjifc`][\][[YYYWkÿʫpX[[]]Z[[[ZZ]]__]\\Ybnrpnjijjmkkhffdhiiifc_a[ZRPPMOOONOONMOOOW\][ZZXWVVUURRQQQRRRQPPPPPOOPPPOOROQPPV__ZRMFEDDDCBCDCDBEBDDDCDCDCDCDFDDCCDDGEDELW]]ZYWVRQOLKLMIILLKLKLKLLKLLJMLNLMKLMNNV_``]\[YXWVSSRPOPPPPPOPQQPOPOQOQRRQPQPQV_ec`]^^[YUUTRRQRRSSPRNGEFD@<989876:@KZejijkklosvyyvlaa\SLHGCCA@=?>==>;=><<9;;:;;;::9:89:79876765;7667753655655545366653322342222215>?>>==<;:;<;;;:9:777666555554343333322220010011000000.....-----...////1014335456789:;=?A?><:786VWUVUWWWVUWVWWWVVVWWVVWVWVWWVWWVWWVWWWWWXWXXXXWXXXYXXYYYXXXXXYWYYWXYYXYXYXXYXWYYYYYYXYXYYXZYYYYYXXXYXXYZXZXZZZZZY\[[Z[Y[[\[[ZYZ\Z[[\[[]Z[[[\ZZ[[\]\\[[[[\ZYZ[[[Z[[Z[[[\][\\[\[\[\\[[[]\\]]\[\\]\]\\]]][]\\^]][]]]]]\]]]^\]]\\][]\]][[\]]\]]\]]\\[]\\[]\Z[[[[YYYZZZ\[[ZZZZZZZZZ[ahmjhfc`_\[\[ZZZXYnſ˸{\Y\[[[]][[Z\\\]\\[X`nqpmigffkjkihdghfgghe]^ZZTROMOONMLOOPONPW^][ZYZXWWUSSRQRPRRSRPRPPPPQPOOOPPQPQQV]_ZRKHFEEECBDDCBCCBDCDCBACCDDCDDBDDDEDFFFMX][ZZWSSQNMLMMLKLKKLLMMLLMLMKMMMLMLLLJMV_a`]][[ZXVTTPPRORPMPPQRPPOPOPQQPOQPOPQV`da`_^_[YWTTRQPRRSTTTNIGGFC<:;::87834CXehihijjklpqpnhd^UOKGDB>????>?=<>==<<;<<;;=;:;8;;:998:::69:7776648755554566746452222121232238>A@@??>>?><<><;;;;<::;889877667665665443333322221001111/00000./.--.--....000001131333456678<<>?>=:9797VWWWWWWWWXWWXWWWXWXWWWWXWXWWXWXXXWWWWXWXXYYXYYXXYZYYXYXXYZXZZYZYYZYZXZYYXYXYYYZYYYYYZYYYZZYZZZZZZYZYZXXYZYZYZZZZZZ[Z[\[\\Z[]]]]]\[[\\\[[\\[\[\]\\\\\\\Z\[\\][[Z\ZZ]\\][\^][]]]\]^]]]\]\]\]]]]\\]]]^]]]^][^]]\\]]]^]]]^^]]^\^]^]\^]]^]]\^]\]\]]]^][]\\\[\^[\]Z]ZZ\[[ZY[[Z[[ZZZZZ`imjjfea^\\Z]ZYYYZrÿ˸y[YYX]\\\YWZ[\\Z^Z\Wbormjkifghjjgfeehjfhie^]ZYTPOOONNOOOPPNPOW]^[[ZZZWVUSSSTRRQQRPPOPRRPQQRQRQRQRQQX_^XTLFDEDDCADCCCCDCFDCDCDEDGEDDFEFFEGFEFFMY_\[ZXSUQPNJJLMLIKLJLLLLLLNKKKMLMLLLMKMX_b__]]ZYXVTRRPPOQPQOOORPPPOPQPRRQPPQQPWbfb``__\XXTSOMPSTRSSTQMKIEB;99;<;99649I_ghihihhkillmkjf_YRLFC@A@?@>=??>>;;;<;<;;;;;98<8<:::::;7888767666574445545554463413352223339?@B@?@@?@=>>=>=<<;;<;::9887767686656556433433233201121120001100.-.-.-//00000011222334446668:;<=>;;9896WXWWWWWWXWXVXWWWWWWXWXWWWWWWXXXXXWXXWWWXYYZYXYYZYYYYZZYYYYZZYYZZZZZZZZZZYXZYYYZYYZZZZZZZZYYXZYZZZYZZXYYZYZZYZ[ZZ[[[[[\\\Z\]\[\][\\[\[\]Z[][[][\]\\\\\\\[ZZ[[[[[\]\\\][]]]]]\]\\]]\\]\\\]\\]\\]]]][]]]]\\^]\^]\]\]\]^\]]^]\^]]^]]\]]]]]^_]^\]]^\]^]\^]\]\\]]\[YZ\[\]Z\[Z[[YY[ZZ[ajnljgc_^\^\][ZZX_ȳy]W[ZZZ\\[WXXZ\X\WWVbmolilhfdfggffggiiefih_]YXVRPOPPOOOOONONQY^_][[ZZWUUTTSTSQOQQPQOPRQQRPRSQOQQQQRX`^YSMFEDDDDDCCDDDDCEBDCFEDEEFFEEDEEEEGGCGOY]][ZXVRPONLKJLLLMLKLLLLLKLMJLLMKLMMOMOX_`_^][ZZYUSRQQQQQPQPPPOOQPQPQQRRSQQQPRXbeda`_^\YWSPLKPRRRRRSSROIE@;::99896655D[dfghhjighhhjikijeb[VMGFAA>>==>??>=<=;;;;:;<;;:;9;;;;899=97864545655453363354665343322332238?BB@@?>?>>?>>>>===;<;;;<;:9777765666665555333333220123211001000./../-/000100122122333346488:<:;:999:66XXWWWWXWXWWXXXWWXXWWXWXXWWWWWXWWXXXWWXXYYYXYXYYZYYYYZYXYYYXYYYYYYYZYZYYZYYZYZYXYYYZZXYZYXYYYZYZZZZYZYZXYYZZZZZZZZ\[[[[\\[][]]\]\\[[\][[\]\[[][\\[]]][[[[[Z[[\\Z]\\\][\\]\\]]]\\]\^\]]]]\]\\\]\^\\\]]]]]]^]]]]]]^\\\\]]\]^]]^]\^]]]]^]^^]]]]\]]]]]][^[]\\\\][[[[[YZ\Z[Z[\Z[YZ[Z[_jlliheb^]\]\ZZYWf¼¼ɵ|\[ZZY\[YZYYXXYWVVTValnkkkgecefedffdihfccd^XYYTSPPNNOOONOPPPRY^^[[ZZXWVURSTSRQRPPPQQPQPQRTRRPQQQQPSY__ZTJEEDDDCDDDDCDFDEDEEDCCFDDEDDDHHEEEDEGNY_]\[YUSPOMLKJKKKLJMLLLKNKLLKLMNLJNNMNNY_a`^]\ZZWUVTSQQQRQPPQRQQPNPPPQRQORPQPQXbfda`^]\ZXUQKJNQRRSSUSQOJG>:;88:987666BV_abeefgegfhhgghiiihe`]WOHE@A>>@?>>=><<;;<;;:::9:;;;9;89:97774535456565443243464333233343328@A@A@@@?>>??==>;==;=<:;;;;88877757765655444443423221222110000000.//..///011111013334443667799;;97:;866WWWYWXWWWWWWWWWXWWXWWWVWWXWXXXXXWXWXXWXXYYYXXYYYXZZYXYYYZYYZZYYYXYYZXYZYXYYYYYYZYYYXZZYZZZYZY[ZZYZYYYYYZZZZZZ[YZ[[ZZZ[[\[[[\\\\[[\\\][\Z[\\][\\\[]\[\Z\[\\\\Z[\[]]\\]]\\]\\\\[\]][]]]\[]^]\\\\[]]\[][]]]\]]^]]\]]^]]^\]^\^\]]]^^\]]]Z]^^^]^^]]\\[]Z\\]\\^\[\YZZ[\[\Z[[[[Z[YYZY[ajojihf`]\\[Y[\Z[nɿĻʸ]\[WY\\[[YVVZ[XWSUV`jnmjjgc`bdcbdecghfcaa^ZWVVTQQPOOOPPONPQRZ_^]\[YXXWTSTRSQRRQPRQQQOOPRSRPQQRQQRSZ^_YRIEDDDCDBCDDCDDBDCDEDDFDDCDDDDFEDFFFEEOZ]]ZYWVSPNKKLKLLKKIMLMKLMKKKNMKLMLLNNLPX_a`^][ZXWXURRPQQQPRQQPPPPQPPQRPOQRRQSSZceb```^]XXVQJLPRRRSSUTTRMI@9;97<;76879>MW_]``abbddeeeecegfiijiec\WOHBAA@?><><<:;;;;;;;::::;9979988775554564543643463543344233522128@BA@A?A@?>?>>>=>;<;;>;<:99;8888778886756544344333322321211/010010/./.000101112223356433656:8;8779:7766WXWWWXXWXWWWXWWWWWWWWXXWXXWXWWXXWWWXYXXYXZYZZYYYZXYZYZYZYYZZZYZZZZZZZZYZYZZZZZZYYZZYZZZYZYZZZYZYZZ[ZZZZZZZZZ\Z[[Z[[[[[[][]\\\]]]\]]\\]\]\]\]]]]\]]]]]\\\[\][]]]Z\]]^\]]\]]]]]]]]]]]^]]^]]]]]]]]^]^\^^^]^]^]]]\]^]^^^^^^\^^^^]]]^]]]]_^`_^^]]^^^]]^^]]]\]\\\\\Z[\[\\\[\[Z[[ZZ[\\`jmkjheb^^^[ZZ\\\o¹ľ̶`\ZXY]\\]\YWXYTWTVU_hpnkiffcdfdccabfieca_\YWXXVSPPPQPOOPOOORX^^^][ZWYXVSRSSRRRQPRRRRSQQPQQRPRTRQPSZ`^YRJFEDDDDCDCCEDBBDDDCCDDBEDDEFDEFEHGEEDP[^\[ZXTSQONLNLNMKKKLLLKLLLLMLOMMMLMLLMQ[a``^\\[YWWSRSQQPQQQPPOPPQQQQRRPPRRSSQR\beda_`_[YXVPMKOSTRTTUVWTNG>9;:;8878797;ES[[X[^^ZZ^`bbbbbbdghgfhhgfc]L?@>@>>>><<;;==;;:;<;978::9<8768446545234233464334543343334334:ABAAA@@@>@@?>>==<=<;;;:;;;;:9987898776666654534433332212221100100211./0/12212334455766567:;;977::88866WWWWWXWXXWYXXWWXXXXXXWWXXWXYXWXWXYXXXXXXYYYYYYZYYYZZZYYZYZZYZYZYZZZYZZZZZYZZZZYYZYZZZZYZYZZZZZZZZZZZZZZZZZZZ[[[[[[\[[[[[[Z\]\\]]]]\\\]]\[\\]][]\]][\]^]\\]\]]\\]]]]]]]^]]\]]]\^^]^]]]]]]^]]]]]]^]^]]]]]]]^]]]_^^^]]^^]^^^]^]_^^]]]]_]^^_^\__^]^\]\]\\]\[]\][\\[[\\\\[[\ZZ[Z[ZZ[`knlhhea_]\\[Z[]ZkĽǿ̹a[Z[[[[ZZXTSWXSVUWS_jmkjigedddadb``bfca`a]\XVWVSQRPPQOPNPPOS[_]][\ZYWVXTTTRRQRRPRRRRSQQQQRSSSRQPQRY__XQJEEDCCDCCCDDDBDDEDDDDDDDCDDEEFEFFHEFHR[^][ZXWSPMLMMLNKLLLLLLLLMMMMMONLLKKMNMP[`b`_^[[ZXUTUQQQSQPQOPROQPPPRPRQQRRRRUT]dfdaa_`\ZXSQMIMUWSURUVWWQG=;97:;:98989=>>=;><=<=<;;;:::9:89;966445545355244576554564363433235;@BBBABA@@A@?>>>>=<<<;;=;;<9:::9789:8876666555543433332213110011210012/01121232346776555689::999;878967WXXWWXWWWWWXWXXWXXXWWXXXVXWXWXXWXXXXXYZYYYYZYYZYYYXZYZYZYYZZYZZZYZZYZYZYZZZZZYYZYZZZZZZZZ[ZYZ[ZZZY[YZZZZ[[Z[[\[[[ZZ[Z\\[[[\]\\]]]]\]]\\]\\][\\\\\\]]\\]\[[\]]]\\]]]]]\]]]^^\]]\]]]]]]\^\]]^]]]]]^]]^^]]]]^]\]]]^^^^^]^\]]]]^^]\^^]^]^^__^]\]]]]^]^^]]\\^[\\[\\\[\Z\[\\[[Z[Z\YZ[bjljjifb``\[Z[\[YsĿ˷a_]\Z[XYZWVUTRQRVXWbkqlhiffededdbbabbbbba`]ZYWVRRQPPQPPOONOT[__][[YWWVTTRRRRRRSQPQQRQQRQQQQRRRRQRSZ`^XQHFDEEDDDCCDDDCDCEDECCBDEFCCEFDDEFEGEIQ\_\\ZXTRONMLLMKLLKJJLMKLLNMMNLOMNMMMMMPZa```]\[ZWUUVSRPOPQQPPQQQPOQRPRQSRRRRQR[ffcb`_]]ZYRLIJLUZWVSTUWXSH=98:;;87::8<>BCKWVOHLQVSOOOPUWY\\^adeggddhWCAA>?>=?A<><;=;<<>::99;:6779899765345542355434443342454223435>>>>>>==<=;=;;;;<:;:988889877766665555333332222212111110201220111233323566666667:;;98::98:786WXXWXWWXXWXXWWXXXWWWWXWYYWXWWXXWYYXXXXYYZYYXXYYXZXXYZYYZZYYYZYZZYZZYYZZZZYZZYZZYZYZZZZYZZZYZZZ\ZZZZZZZZ[Z\\[[Z\[[Z[\[[[[\Z\][[\\]]^[\\\\]\\\\\\\]]]\Z\[\]\\^\\]^\]]^]]]][]\]]]\]]]]]]\]]]]]]]]]]]]^]]]]]]^]_]^^]\]]^]^^]]^]]^]^^]_]]]^^_^^^]^]^]]]\]^]\[][Z\\\\]]\\\[Z[Z[\[ZZZ]ajnlkhec`_]ZZY[\cͱx[Y][X[Y\[XURPPQRVXXbnpkkhigdddcddc_bc``ca_\YYWVTSRQORMOPPQPS[_`^[[ZYVWSURSRRRQQRSQQPQQQRRRQQRSQQRRZ_]VPIGFDECDDCCDCDEFBEDDDDEDDFDDEEEEDFDDGHR[][[YYURPNMLLLLLJLLKLKKLLLLNMMNNNMNNMMQZaa`_\][ZYWTSRRRQQQORPQQQQRRQRSSRSSRTPT]gfbb`_^]YSJDFGHRZYTWUUVWVL=768:<9;978;ACCCLSSKBCHNSRMIIIMPUX\\`dd`aeWEB??@AA@?>>>;<;;<=9;>889::86887566445444244445454342334233346?>=><><=<<=;:;9:;8:::9789887676576553333323223222222221022101122223345667666778::8788:7:879XXXWYYXXXXXWZYXWXXWXXXYYYYYZXYZXZYZZYZYZZZYZZYZZZZZZ\ZZY[[[ZZYZZZZZZZZZZZZZ\Z[[[ZZZZZZZZ[[ZZ[\ZZ[ZZZ[[Z[\\\\\Z\\\\\\\][]]]\\][]\\][\]]]]]]]]\]]^]]Z[]][\]^]\^]]^]^]\]]]^]]^^]]_]]^^]^^^^^^^^^^^^_^__^^^^^_^^^____]]^__^_]^^^\^^^^_^^]]__^^^_]`\_]]]^]]]\]\\\]\]]]][\\[[\[\\\[[]_knlkhec`^]\ZZX[n˵c[XZ[[Z[[XTRSPPRUYZfqrmhiihgfeddddabdcbb`^][YVWURSRPONPOPOQTZ__^\\[YVWVTSRQRRPQQQRRTRSRSQRQPPRRQQSY_^VNIGGDCECADEDDDEECCCCEEDDGDDDDCFGGDEEGGT\^][YWWSQNMLLMMMKKLKMMLKLMLMNLMNNLNMNNS\baa`^_\ZZWUSRRQRSRPRPQQQQRPRRTSTSSTSRV^fdbbb_^[VMFCCDHNY[UTTUWXYM=998;;;;989==;<=<;<<8:;::96:77563544554443455543333423234336@?>>>>==><;=;:<=;;:::::998788788665543434333333333322333222211233434657677666887677:889:9:7WXYYWYWXXYYXXXYXXYWXXXXXYYYYXXYXYYZYZZZ[YZZZZZZZZZZZZZZZZYZ[ZYZYZYZYZZ\ZZZ[Z[ZZZ[ZZZZZZ[\[ZZ[ZZ[ZZZ[Z\\[]\[[[\]\[\]\\]\[[[[[[\[\[\^\]]\\]^]\]]]]\\][\\\\^^]^_^]]^]]^^]^\^^]]]^]]^]]]^]]^^]^^_^^]^^^]_]_^^]_^^^^__^^_^^__]]^^^^^__^^^]^_^^^^]_^_]^^]]^]]]\\]]\\]]]\[[\[[[Z]Z\[[[bkolmheba^^\Z[\_uÿǼiW\Y]]]\\VRQROQSTUWcpqkhjjgefgfedcb`eb`__`]ZXVVVTRRQQQOPPPPRZ_^^\\[WXVWSRQRRQRQQQRQPQSRQSQRRSQPPRS[`]WOIGGDCEDDDFDCDDCEDDCEDDECDDCFFFDFDDFGIU]_[ZYXWTQMMMLLLNKJJMLMLLLLLMJLMLOMMNMNS\ba`^_^\Y[VVTRRRRRQRQQROOQQPQQQRSRRSSRV_ffcba_[UMHDBEDELV[XUVVVXXN?<8:<<;<::9757=JLMLHEDDEENY^^^f]JFEDBAABA@A>=><>;;>;<:;::978668554466753444444465454433333335>CDB@?@AB@A@???>>>>=>===<;<;;;;;:::::887787766565444433332233313323333232213333466566756777556876799:98YZYZYZZYZZZZZYZZXZZZYZZZXYYZZXYZZYZZ[ZY\Z[[[Z[[Z[Z[[[[Z[\[[Z[[Z\Z[\[[[][\[[[[Z[[[[Z[][\[\[\[\\\\[\\[\\]]]]]]]]\]]]]]\\]^^]]]]\^\]]]]]]\]^^]]]^\^\]]^]^\]^]^^^_]^^^^^^_]__^_^]^__^`__`_`^`___^_^____````__^^`^``____```^___`^_^`^^_`___baa`^_^_^`^_^_^^]]\^]\]^_^^]]]][\\]\[\\\^blpmljfb`]^[Z]^fƿ˜hZ[ZX\_[[UPPQRPQTVYdppkilihfehhfcdbbc`^_\^[ZZVVWWSSRRRPRPNPSY^^^Z[ZXWVVUSRRRQRQRRPQPRTSRRQRRSRSRRS[`]UOHFEEDDDCDBDDEECCGDDFEDDDEEDEGGDDFEEHJU__\\ZYUSQMOMKLLMLKLMMMNNMMLOKNNNNONMLKS\`b`_]][YXWVTRRRQQPQQQQQPQQRQRRRRQRSRSW_ffdc`_[TIECDEDDITYZVTVWXXM@<::<<<;=;:=BGFHEGGA<;6341:BDGMLIE@BBS^\^f`OJHIFCBBA@A??==<<=<=<=<:;8;8477753565544455665467585333344539>DEDC@BBA@A@A@A?>>?==>>===<;<;<;;;:8:9::::99:676643444433333332322333332332233356567776699767677799::98YYYYZYZYZYXZYYZYYZZYZYYZYZZZYZ[ZYZZZY[[ZZ[[[[Z[ZZ[[[\[[[ZZ\[ZZ[ZZ[[[Z[Z[[\[[Y[\[[]\[\\\[[[Z[[[]\[\\\]]^]\]\^^]\]\]]]\]]]]\]\]]]]]]]]^\]\]\]^]]]]]]]\]^_^_`__^__^^^_____^^_^___^^___]^_^^`^_____`^`_^``_a````___`_`^^`_`^`__``_`____^`_aa_____`_`^``_]^]^^]]]^_^^]^]^\\\\\[\[[]\clpnligda_^[\\]jƗfYZWZX[XWRPOQPQPRSVcnpmjhghgfgfebdaa__]^\[[ZXXWUUSSPRRRPOOPS[^][\[XXWVRSTRRRRRRQQQRQQQRQQROPRPQPQV\`]UNGFDFDDDCDBDEDDDDEDDDDDDEEEEEFFFDFEEFKW`_]ZWXUSQNNLLLLLJLMMMOMMLLKLMNMMLNLMNOU^c`^_]\Z[XWVTRTRQQPPPPQRRRQQQTSQRRSSRSW_ffca`^]ULFEEGDCFMVXXVWXXXRC=;;;=;;;<:;AEGHDEFB>;6551146;BIJJFA@P`bchbSNLIHFEDCBB@@?=;<=:;<;<<<97967754456246654656556655443353354:?EDBA@BBAAA?@@@@??=@>>>=><==<<=;;:99:::;<;:9777666654343324333234334323331334455554666668976667688;:9:9ZYZYZZYXYZYYZXYYZZZZZZYZYYZZZZYZZZZZ[[[Z[Z[[ZZ[ZZZZ[Z\Z[[[[Z[[Z[[[Z[\\\\[[\\[[[[\[[[\\\[\\[\[[\[\[\\\]\]\]\\]]\]]\\]]]]\^]]\\\]]]]]]^]]]]]^\]]]]]]]]^_^]]]_^_^^___^^`^_^^^_^__^``_____`^_``^_____`^``_`_`_^`____`___``^`^______^_`____```^_`__^^^]_\]^]\][^^]^^^^]]\]\\\\\[[\\\elqnlhfc`^`\][\k½ǘgWXVYXVSSPNNONQQSQVcnpljggfgffdcab`_\\^__^\[WXVUUSRRSQOPOQQRZ`]\\[XXUVUSTRRRRRQQRQRRQRRQQRQPRSQQPU[`]VOHEDDDDDDCDDDEDDCDDFEDDDDEECDDEGCFDEFJV``]ZYWSSQONONKLLJKMNMOLLMLKLOMMLNNMNMMU]c`a]^\][[XRTVURQOOQPPPQQRSRQRRQQRTTRTWageea`_]XQIFEFDCBJTWXWZWXWSKC==>>>=>=;=BGIIIEGGA:764541458=FJJEBRdiildYUOMMLIHGEBCA@@?><><<=;;;;::77866455545566645467576555433465:BDCCAABACAA@AA@??>?@>==>=?=<==<;<;;::::;<;;9;88876644344433434444343334544435554445667677766575779:;;:;ZYZZYYYZZYZZYZZYYZXZZZZZZYZXYYZZZZ[Z\ZZ[[ZZ[Z[[[Z\[[\Z[ZZZZ[[[\[Z[[[[[[[[[[[ZZ[\[\[\[[\\\\[[\[[\\\[]\]]]]]]]]]]]]]]^]\]]]]]^]]\]\]]^]]]]]^\]]\]^]]^]]]^^^^____^_^^^_]__^___^`^__^_`^_`]_^`________`^`a____`___`^_`_`__```__^_^`^_^_^`^`a__`^___^^^^^^^^]_^]]]^]^]]\\]]^[\[\]\\\clomlif``]\[[]]oȾƗgVVTVVTOQPNNONPRPSUconkggefeeccc`^]][Z\ca][ZYXWWRRQQQQQQPPQTZ^\[[YYYVVSTSRPRQQQPPQPRRSPPRRPPQSRPQS\`\VNGIEBCFCDDDCDBDCCDCGFDECEDEDEEDEEGFEFHW^_\[YWTRPPNKOMKLKMLLLKMLLLMLLLLLLNLNMOT]c`_^]]]\YVWTSRRSRPPQSQRPORQPRRPRRRRSTXbgfcc``]XQJFEEECBFOSWYWVXXVPKCCBBA@@??@BGIJKGGIA>977742378?EJMJDQfonph]YVSQOPOKGGFEBAA?=<=<;<;;<<;:8775456456444675455465554444457@A??>>?>?>==?=;;<;<;<=<<<<;;::9886665544443433434554333433455554765557686666666989:<:9:8ZZ[ZZ[ZZZZZZZZZY[ZZ[ZZZ[ZZZ[YZZ[Z[Z[[[\[\\[[\\Z[\\[ZZ\\\[\[Z[[][\]\\[\\\[\Z[\[[\]\\\]\\][\\\\[\\]]]]]^^]]]]^]]^^]]]]^]]]]_]^^^^]^]^^^^^^]]^^^^^]]^^]__^__`_``__`___`___`___`_`__`_`_^`a````````_```_`___```_``_``````a_```_```__`_``^_a```aa``_`__^^^]]^]^_]^^^`^]]^]]\\]\\]^]]clpnlhhdc__]^^_kɑ_SUTWVTSPNNNPPPQOQUdmljhfeeefeaa`\\][Y\`^][ZWXVURRRRQQRPPOPSZ^][ZXYXUVURTRQQQRSSQSQPPRSQQQQQQQRORU\`\TMGHFCCECDDDDDDCDDDDDCDECDEEDDEFEEGGHHKV`_][ZXUSRNNNMMKLLLKLMNMLMNMLLMMMMNNNQQX_db`_]][[XWWRSSRRPPORRRROQRRRTTSRRSSUUXbffbb``[SNJGEEFECCLSXXWWXYZVRLIGGGEDCDDFHJNMJIIGB;8866433=JQOOLJSgsrqkb^[XXSRRPMJJHGDBBB??>>=<<<<;979:6756555555576566555545454466>@CDEEBBBABBBAB@AAA>???>?@@?=<>==;<;=<<==>=<<:;8:966655444545445555434445566776676677979776666;;9<=<:999[[ZZ[[ZZZX[Y[Z[ZZ[Z[[Y[ZZZZX[Z[Z[[\[\]Z\\[[\[[\][][\[[\[\\Z][\Z\\\[\[\\]]\\[Z^\\\]\[]\][]\Z]]\]]]]]]]^]]]^]]^^]]]]]^^]^]]]]]^]]^^]]\^]]]_^]_]]]]]_^_____``_`_^^^`_^`__`__]__`````^_```_`a__```__`_``_``_`a`_`_``a```a`_`_`_`_^_`_b_``_aaa^`_]``^_^^]^__]^]^^^_^^]]^]\]]]\\[]\^]dnpnljgc`__\\\]jĻļNJZTVTTTSOOONMOPOPPRTakikhggfffdab`][[\X\`\\\YWUSUQQSPQQOOQORSZ^^[YZXVURSRSRRRRRRRQRRPQRSRQPQRTTSRQS]_^UMFFEECDDDDDDCDDDDDCDCCEFFFCDCFFEEFGGHLX`^[ZYWTRQPLNNMMLKLKKLNKMMLMLLLKMNMOMLOW_d```]]\ZYXVUTRRQRQRQRRPQRRRRRRRSRSSTUYchgcb`\YROMGEEEDABKSWXWWWY[YVSRONMKJIHJILMQONMKGC=;822343:IWZTTTXitrqmeb_]]YXVSQONLHGFEDC@?@==<=9967986646546535754456565566435666?<;=====<=<=>>=;<<:9:6664664665444554555334345567777668:897676458:=<;<;:778[][ZZZZZ[[\[\Z[[[\Z[[\[[[Z[Z[[\]\\\]\]\\[\[]\[\\]\]]]\\]\]\^\]]^\\\]]]\\]]\\]\\]]]]\\\]\\]]]]]]]]]^^^]]^^^]_^^^^^_^^^^^^^_^^_^__^^^_^^^^^_^^_]_^^___``__`_`a_``a``a__a_a`aa````_`b```aaa`aa```aa`a`aaa``aaa``aa`aa`abaaaa`a`aaaaa``aa`bd`aaa````__``^_^___^`___`__^^^]^]\\]__^^fopookhdd_]_^^ZfȿĈ[TTVSROPPPNNOQPQOPUammjhfegggea`_]\^^[__[[[ZVUUSRRRRQQQPPOQU[]\\[YYWWURQRRRRSRRRQRRRQPQQRQRRQPQPRU]`[UMGFEEDDDDDDDDDDDDDCDDDDEGFGGFEEGHFFFHLY__^][VVSOOLLLLLMLMLLLMNNLLLLNLMMNOMMMOV_cba_^]]ZYXUTSQRRQRQRRQRRRSQRPSRTTTTVVXbgfb`\YWTQOKHEEECBFRWWZZZ[\[XWWWVTSRPNOOPSVWRPMLFA>:634248GX]X[cdmwvtofedb`_][YXURPNMKIGEEB@>>>><;;;867767777655666666665656466677>EFFEEDDDDBACBBAABAAAACBA@@?@???><<><=;=>@>==<;;:9877665565653655554444455666789999:;:86876667<<<>=:8668[[\[\\\[Z[[[ZZ[[Y[\[Z[ZZZ[ZZ[[Z\[[\]][\\\\\\]]]\\\\][]\]\\\\\]\\]\][\\]\\\]]]]]]]\]]]]\^]]]]]\^]^^]]]^^^^_^^^^_^]^^_^`^^_^`]^___^^_^^^^__`__^^_^^_``^`a``a`_````^a`````^b```aa``_a`a`a``aaa`aaa`b``aa``aa`a`b`abb`a``a``aaaa`a```a````aaab``a`_`_`^^^__^^^__`_``^_^_^]^]]\]^]_\emppmkgdc`_^__[]qùȏ^USTPONNNONNOQOPOQT_llkhedfeeca^][[\][]]YZYZWVURRRRPOPRQPPOT[^\[ZXXXVUTSRRSSQRSPRQRRRQQQRRRSRRRQPU^`\UMGGEEGDDDDDDCBCCDCEEDDDFFFEIHEGHGGFHIMY__^\[XURQPMMNMLMLMLNMMMLMLLMLMNMNNNLMOV`bba`_]\ZXWWUSRSQQRPPORQRRRQRPRQRUUSSUXbged]XWUSRQKGEDDCAEPVXXZZ\^^[XWWXZZYXXSSSWWYWQOMJF@<754455>V^]^ipsywvqieedcd``_]YYTTRPLHJGHDBB@@<<:9:86753467655665655665656567778>FGEDDDCCDCCDBBBCBCAAAABB@AA?@@??>>><<=>?A>>=;=<;;868766665666666644455445667889:899:8666556688;<:976666\[\[\\\[[\[[[\[[[[Z[Z\[\\Z[[[[\][\\\]\\\\\]\[[[\[]][\]]\\[]\\]\[][\\]\\][^\\\^]\]]]\[\\]\\\]]]]]]]^_^^]^^^^^_]^^]^^^^^]_^]____^^_^_^]^^^_^^^____`__`a```a```````baa`a````__````a`abaaa````aaa``a`_aaaa`aa`b``a``a```a`ba`aaa`a`aaaaa`bab`a`a_``^^`__`_^]___``^`__^_^^_^^]]]_`^^dlqplifbb`]]]\]`wǿ˾ø͖_VURPONMLNNNPSQOQNQbmmjfecdeda_]\\\]\\\ZY\YXXXURRQRQQQQQPPPT[_]\XXYWUSTSSRRSRQQPRRPRRRQPQRQRRRQRSW]`]VLHHEFEGEDDDCCFEBEDDEEDDGEEDIHGHGEHGHGLY`^\[YXUSOOMNLMMMKMLLMNLKLMLLMNMNNMPLMOY`ea`^]]][ZVVSRSTRRRQPPRRQQTRSSRUSTRSSUYdiec]VTRSPOMKHEDCBDNTWYZZ\^`_XVWY[[[^][ZWX[[XTPNMGB>974467=Q`^_isw{ywqiggfeecdba_][YWVSNMLJHFECC>=<78:7775666555567655545675556568?FGEHFDEDDCCBBBADCBBBBAAABA@@???@>==<>=@AA>>==<==::86676566666655444464445666679888:87566667567;99864454[][\\\\\\[\[[\\[[[[Z[ZZZ[[\\\]\\[[\\]\\\[\]\]\]]]\\]\]]]\\[]\][]]\\\]]\[]]]]]\]\][]]]]]]]]]]]]^]^]^^]^^^_^^^^^_]^_^^^^__^__^^^`]^^]_^^^]^^`^^^^````````__``_a````````_a`__a``a`````b`a_aa``a`_aa```aaa`aaa`b``b``a``aa```a`ba```````a`bbbb`aa`_`__^_`]`_`^_^_^^_^_^^^^]^]^]^_\^dlsqmlhda^^^\\[dŻΙaWTRRONNMMMLQQOOMNP_lnjggdbcb^^_[]Z\\[[YXYYXVUUSSTRPRQQRPOOU^]\[YZXWUTUUTURRQOQQQQRRRRQQRRQRQQQPRW^`[RKIGEEFGCDDDGCDFDDDDDCDEFEDDEGEHHEJHEGM[`_\ZZXURNPNNMMMMLLKKMMLJMNLKLMNOMMNMNQY`da_]^^]ZYWTUUSTRRQQQQRRQRRRRQQUSSRSSRYdhfe^XTSROPMLIEDDBDMTXYYY\__^WXXX[[\^_a`]]]__[TPNKD?:87556:N`b`hvz~}zskfhhgggfeaba_]\YYUTROKJGFEB=:7997686766455557755555566657756>DGDDFDFDDDCDBBBDCCABBBABA@@@@????=>>>?@BA@?=>==<;876666665666664543456663666788989975556564656986455333]\\]\\\\\\\]]\]\[]]\Z\[][[[\]\]]]]]]]\\]]]]]\^]^\]^]]]\\]\]]]]\]\]]]\\\^^^\]^^]]^]^\^]^]]\]^]^_^_^_^___]^^_____^_^```_^__`_`_____`__^__^`^]`_^_`_`_```_`a_``````b``````a`a`a``aaa`aa`a`aaa`ababaab`a`b`ba`aa`ababa`_`aabababbaa`bb``aabbdacac_``___``___``_`````^_^__`]^^]^___]dnqpoliec`_^^^^`sÿż̒`WRPPONNLNNMOPNNONQbklihgcdbc`^^\[[\]]ZYYXVWVUTSRPQQRPPPPOPU[^\\ZWWWUWUTSRRRQOOQOQRRRRRQRSRSRRSRTX^`[QLHFEFFGCDDDHEGEEFDEFEDDFEGGHIGGGFIIFGN\`^][ZXTSPONNOONNMLLMNMMLMNOMLMOONNNNPRZacaa``^\ZYVVTTRQRRQRTSRRRRRRSRRSTQTRSU[egedaZWTRRONOMJIFEDJSYZZZ^^]\YVXYY[]^beec`_cc^WPNKHB=965576F`eafy~ztliiiihhgfdecba_]\\\XSPPMLGDA=:88:986655455665656665788667757?FGDFDDDDDCCCDDBDCDBABBCCCA@?>@@??>>=>@AA@@??>>==<:9787766656676755566555566778::<9765466555566655533322\]^]]\]]\]\\][\\^\\\\\[[\\\\[]]]\\]][^]]\\]]]]\]^[^]\]\\^]\]^]]]]\]]]]\]\^]]^]]]]^]^]]\]\]]]]]^^^^^^__^____^__^__^^___^__`_`__`^`__^_^_`__^`_`_``aba``````_`````aaaa`a`aba``c``aa`a`a`a``baa`ba`abbaaa`aa`aaaa`aabaca`ba_b`a`_a`a`a`babcca`a``^_a_``_^``a``a`_`_____^^_^^_^___^dmrpokjeb]`]_^]\jɽƹµȇ[USOMKKKKKLOOMOPNPQ`lljggdcbb`]_\\[Z[Z[WXWVWVVTTRQRPQPQQNOOU[^[ZYWWWTSUTRSSSRRSRRRRTRRTRRRRTRRSRSX^`ZSKIFFGFEDDDDEDEDBDEHEDDEFFEGHGFFHFGIHIO\`^\\[YUSPOMONNLLMLLLMNNMOONONNNMMOOOOQZcda``^_\[YXUURRSSRRTQSRRRQRRRTRTUSSTST\ehgdb]WTSQQOONKMIIEHT[Y\\]^^ZVXYZZ[]_bfgheccda[TNMHC?;78767D\fbfv|wpkkijjhhigeedca`_]]\YVUTPLG@>;:88;67765666664657576666566778@FGFGGEFEDDEBDCDDCACBABDDCCBA@BA?@>????AA@@@?>@=<=99:877687666676666566565566789::9965765555444445332222\\\[\^\]\]]\]]\][\\]\]]]\\]\\\\]]]^\]\]\]]^^]\^\]^\\]^]\\]]]]]\^]]\^]]\]^\]]^]]^\]]]]]^]^]^^^]^__^]_^^__`^___``_^^__``__`_^`____________`_`__^``__```a``aaaa__aa``ab`aaa````a``a``b``aa`a`abaaabbbabbb`abaabaacaaa`abaababba`aabba``aaabbbba__`__``____``a```a`___^^]_^^`__^^]^enqqnljfb`_]^\\[cüͿ¸À^YTNLLLHKMNMNPNPROT`kkhffdc`a`^]\\YZ\\YWYWVVWUURRRQQPRQPOOOU[]ZZZXYWVUUWTRRQRRSSRQQRSQRRSRRRRRTQSY_`YSKHGFDEDFEFDDDDEEEEEEDDDEEFHFGHIEEGHHHQ\_^\\ZXUTQOLMNMNMLLLLLLLMNOMNNMOMPPNNQQ[ceb``^^\ZXWUVTSRRQQRQRSRSRRQQRRTTTUSTU]eigdc^WWSRQPONLKMMFEOXY[\\_^[WWZ[[]]_cgjjgggif`WNLHFC<:9797AZidbr{wrkkljkkihfgfedcaa``^]\YYVPKA?=:8675665464556676567776467766;DEEEEFGEGGEFECEFCBACCBBBBDBCACBAAA?@?@A@@A@A@??>=;:9:876787667678765666666577768988565664545323333221221]\]^^\^\]\]]]]\]]][]_]]]]^^^]]]]]]]]]^]\^]]][^\]]^]^]]\\]]]\]]\\]^^\]]^^]^]^^^^^_]^]`]]^^^]^_^]`^__^^_`^____]^_`_^__`________``___``_``__^`_a``a_a``a`aa```aa_`a`aaa````aaaaaaa`aaabba`cbba`abaa`bc`_b`ababb`aaab`bbaa`baabaaaa```b`abdccb`aa``aa_``_``aa`a````____^_^]_a^^^^]`gorppmida``^]]_\]jʽ¿ӲpVSRNNMKJMKJOMNOPOOTakiggfcba`^]\\[YYYZVUWUUUUUTTRRQQRRPQQOQVZ_^[[YWWVUSTRRSQQRRRRRQRSQRRRRRSRRSRTX^`ZSKFGEDEFDFDDFEDFDGEEHEFEFDEEGHGHFHHHHIR]`^]\ZVSQPOPLMNMOMLLMLMMMMONONMNNOOONOS[ddc`__^][ZYXUTSRPRQPQRRRRRRRTRSURTSSSW]ghffda\XTSQQPNLKPLIFMY\\]^_`[VW\\YX[acgghjijmke[QOJGE<;6776>Thgcm~|wsommlllkihhffedcbc`a]]\[XSMD><;8896675557777667768775777878;CFHEIEGEEGHEDDEEBBCDDACBCBBBDCCBAB@@@@@@@@@@@?>>=:99:898:79987789977666666667766667665655444441112031100]]\\]]]\^\]^]\^]\]^]]]^^]^^]^^^^^^[^]]_^\^^^^^]^^^]^]\^]]]^]\^]]]_^]^^^]^]^_^^^^\]^]_]_^^^_`_``]^]`_`^```_``_`___``````__`_``___`^_```____a``a``aabaaaaaaaaa`acababa`cbab`ac`bbbbaa``aabbbbbaabdbabacbbabcab`b`bacacadcaca`ccabacabaabbcda````a`__`````a``a``_a_____^`__`____^^eptrpnhfda_^^]^]][vοýÿýӤfSPPLJLMKKMKMNNOROOT_jkggebab_]^[YZYYZVUTUTVVVUVVTSSRRRPPPPPV^^[[ZXXWWSTSSRSRQQRSQRSRRRRSQRSRTQSSTY``ZQLGGEEEEFFDEEDDEEFEEFFGFFEFEGFHHGHGGIJQ]`_]\ZXURRPMOQMMNNMLNMOLNNNLNNMMONNOMOS\dcba``]\\ZXXWUTTRSQTQQSRRTTSTUTUTSTUUV^gkghfe^ZVRRRONMPVUJFLX]\^]`^ZVW\]XU[_dgiiikpopi`VOJGE@=9896;869<866655655667556666666678=CGGFGFFGEDEFEGEDDBDDCCDCDBCEDDDCBA@@A@AB@BA??>?><<;89;::8:::;::::998877566677766667776655654221112111101]]_]^_^^^^^^]]\]^]^^]]^]^^^^_^^____^]^^]]_]^]^^]^^]^__]^_`]]^^^_^^^^_^^^^^^_^^_]^_`^____^`^_`_````a`_`__``___`````_a``````_``````````_a_``abaa`aabbbba`d`aaabaaaaaaacbbaabbbbbbdbbabdcabaabbdcbaadbababccccbbccabbcacadbbbabcabaacbbcbdbccbabaaa`aa``aaaa``aaa```a```_^aa``^_^^gosqomjedc`]`_]^]]rɶ¾ĿΔ_POLLKKLLJMNMLOPOOPTdkligfdcb`^^Z[YYZYYVUUTTVSVVUTSRRRRQPPPQX^^[[ZYZXUTUTRRRRQRRRPRRRQQRRSTTSSRSRTZb_XQKHFEFFEDDFDEDCFEDEHDEFFFIFEEGFEHIJIIIQ]a_\\ZWTRQOORMMLNNNLMNMMONONNNOMOOPMMOT\ddb``_]]\YYVVVSUTSRSRRUSTSTSSSUVUTTVTX`higgffb\USRRPORZ^ZQHKYab`^`^ZXY[^][_binqojjpsslf\TNKG@=:8:6==9886786665667658766679787778>>;;===;;;<=>==<;;:::87788788666655554342333320100101110_^^__^^___^]]^^^]^___]^^^_^```__^a____`_^_____^^^]^^`_^_^^^^]_^`^]_^_`]^___________`^__^`__a`````````_`_`_`a```a`a``a````aa``a`a`aaa`a`aaaabcaabbbbbc`babbacbb`bac`bcdacbcdaacbbbdaeacbbcccceddcdbbdbcbbcbbbccccccadccdc`bcdcacdbbbcbcccda`caacaaa`aa`abbb`acaa_`aa`_^``b`_`___fpurqmkedb`_^]^^^^btμ}{|ý׵wSQMLLKLJLKMNKMLNOMOTdlkiggffda^\]ZZYYWWWUWTSTTSTUSTSTRRPQPQTZ`^\\[ZZWWSVSTTSRRSRSQSSQRRSRRSTSRRQRUZ`_YRJHIFGFDEGEDDFEDEFEDEEFDGGFGHGGHGEHHILSaa_\ZVUWTRTOOMPOMMNOPMMNMMNLONMNOPNOOMW^feba_^][ZYWVVUTUSRRRRUTRSUSTTSTVUTUTTX`ijhhfgga[VSRQQXa_XPJJXegfecbba`adinuutuvxvnlrsqng^URND?;987<;;87886666666666676798666676=><;;=<>@<=;<;898877768666556545433223322/100000000^]^_^]__]]^^^^^^^_^`_^^^_^____`_``^``___`a`^_^^^__^^^_^`_^^_^]^_^_]^_^__^__]^`__^^_`]``_``a``````aa`aa````a`````a````a``aaa`baaa`aa``b`baabbaaaaabaaaabdacbcbbbbacdbbbcbcbadbbddcdbbaabbcbcdcccbcdccccdbcdcdbbadcccdbbabbbbcccabcbccbdddbcdcacba`abbabbabbaaaa``a_a_a_``_`a``_`fptronifccb\^^^]]Z^e̸|{yw}¾̣mPNKKMLLKLNMNLNNNKMMSdkjgggfda_^\\ZXZXWVVVVUUVTTUTUUTUSSQQRQPYb_]]ZYWTVRTUSSRRQSRQPSRQRSRRRRRRRQRTT[a`YPIHFDHEGDEGGDFFCEEEDDFHGFFFGIEEHGFHIIJU```^]XTOTTOMPONNMNMONNMLONOMKMIEEJMPOPU_fdcb`_]\ZYXVTRSSRRQSRRTTSSTTRTSSUVSTVY_iigggegb\VSRRW]\ZYSLKVfljighgedccfntwutuuvrnqtrpnbYSOLA;854:Tkpjel}|wtsrqsonmlkkhiiihhgdddda`[RGA?<<:88677666666665366686856645=>@?=;<==>??><;:9;88878766654554434122221220/0/0110//^__^^`_______^^^^`___`^_``__```a`_a`a```a`_^```__^`_`_`_`^__```_`_`___`_``_a_`````^_```aa`ab`a`baaa`aaa`a_b`ab`a`babaaaaaaaaaabaaaaacac`ccdbcccdcbdccccdccdccbcdecdccdeccccdbdceddccddddcddcfeddcecdbeddcddcecedcdccdcedccdedddccddcccfedddbcbacdabaaaaacbaabaaaaa`a`a__ba``aa`gpusqnjgddb^^^]^_]]cx̷||yxw{}bNONKMMMLNLKONNOOOOLTdkiiffeda`^_Z[XXVVWWXVVUWUUUTUUUTSRSRQRT[ba`^[ZYWWUTSTUSRSSRSQSRQRRQQTRSTSRQSS[a`ZQIHIEGFFFDGFFFDDFFFEFHFFGIJIHGFGIIGIHIW`a^_][YWRMNMOMMLONMNNMMMNKPNKONPNOMOOQW`ceca`__\[ZXWVVSRTSSSRSSSSTTVUUTSTTTTVZbjihghegd^XSSS[_^af`RKTkvrpppnljhffiouvvvuutmputsng\SOMG=:53:Totnejy{ytssrrqpnlkkkkiiihgfgeeca]RGA?<;:7;:96646568797666877666568>===<==??<;;:999:88877764454443232112010/////00000```_^_a`_____`_````___``_aaaaaaa`aaa`_`a`a`b_b`a`a__```_`____`_``_``````_`_a`a`_`````a`bbbaa`aabaab`acaabcaab`bbcbbbabccbbbabbabbbb`cbcdddccdcdbbcddbdeccdcbcdccdddccceddddedcddddcebdceedecedeeeeeedececedfddeefecfdedcddddbdccecdcbbfeeeccdbdcdbcccbabbcabbbbba`b`baaa_``b_`_gpwsqpkged`_^__]^^_ajt˱|xz{{|}{~ĿϻZNMMPOMNLNNNNPOMLMMNUdliifecba_^\ZYXWWWXXYWWTUWVVUVUUTUUUSTSV]`bb_][XXVRVTRRRQRRQRRRRRTSRRTRSRSSRRU[b`ZQKHGFEEEFEFDEHGFFDEEFGIIHHKLNOMIJIHHIPV]^^^\ZXUSOMNMOMOOOLMMNOLMNPPOPQNNPOOMOW`fdca`_^[ZXYVVUVVVTSSSSRQUSWTRSUUSUUTUYdjjhhfffd_XSQSZ`bjshTKSi}{vsrorqmmjjkosuwxvvqnrttpk`VRPLB<77;<9:978865457776566846666557>EEDEFFFFEEEDDDDCBBABABBCBCBDEDCDDCBBBAABCEDDBCCCA@?@@?@>=>>==@>=;<:99:888876656553434221201111.00///0000_`_`a````_````a__``^a_baaa`b`aabaaa``aaaabaaaaaaababb^``````aa```aa`a`a``abaaa_a```b`bccbbacbbc`ccbbcbbcabcdbbbbcbbdabacccccbccbbcbcccdeeddcbdedbecceccedddddbeddceeecdeeedeeeceedeedefeefeffedbfeeddceebfedeedeceeddbedeedeeeeeeedccdeeddddddcbdcdbccbabddccbcbbba`bbbbcbaa```grvtsrihe`a`_^`]]aadjlyί{xxvvyz{¿ʵ~TONMOMMNNOQMMNNMMOOMTdkjhheda__^[ZZVWVYYYXVVUVVVXXVXUTTUTTWUV^cca`^]YXWTRUSRSSRRRRRRRSRRRRRRRRTSRSU[a_YPJIGFEDEEFDFDFHEEDGFGIGFHIKIHMPOLJJHKMS[ZVVVSPQTTSUVTRQRRPOMOONOTTQQPPNNNONOMT^gfcb__^\[ZYYUUVTUUSRUUSTWUSTTSUUUUWVV[dkkhfhgeebZXSTY]bkteSIPf}}xutsvutrpomnosvzzyqnquvsmf\TSNF=98=Karuhfr}zwuutrrqonnnmkkkjihhffeea[RGA?>><;9:9:986686687576675745679@GGGGEFEEFDEEDDCCBABBACABBCCEDCDDDCBBCBBDCCGDCDDBA@@B@>>>==?>>@=<;<:99::9:9766645533441021011/1..0/000/00aa`^``___`_```````_`_a``aaabaaba`a`aabaaab`aaaaacb`baaa`baa`a``a``a```aaaaa``aa`a`babaaaadabcbacbbabbcbaacbcacacbabbbbbbcbbcbdbbacccbccdeddeeeceecdddebecccecdcfddcdfdecfddddddeeeedddecedefeeeeeedeeddfccecdeddeddedfddeeefdfedeeddcdefeedfcddceedcdccddbbcbbbbbbaa`bba`_a`abagqutqpkhfdab_a`\_ajqv|~Ϯ~yssposv{ǩtQPKMOLNNOPOOQMOONNLNTdjjhedc_^^^[Z[YVUVYXXVVVVWVWWXVWUVVUUUSW]ba`^][ZXVVSUSSSSSQSRRRSRRSSRSSSSTSSSU\a]UQJFDFFEDDDFFEFHEEEFFLHFEKHHHKJDJJKMQTRWVUWRQPOKKLNNNOPPRQQSTSPPOQUMMPMONONOOPX]aeca_`_\\NINPTVVUVSSTUUTVWVUUSVVVWUVV\flkihgffcb^\XTW\dnj[NFM`z~xwuuvtsttsrqrqsvwxsnovxvriaXQNH@98=DVovlfp}zwvusssrpnnllklljjhhffeea\SHA??=<:8:96776676766665645557559BFFFGHFEEFDCCDDDAABBAABABBCCDDDEEEDDDCCCFEEGGFDDA@A?@@@@?@>??>>=;;;:;8:987966564544542022121001/0//000/00_`__`a`_`_a_`a``a_``a`bbaaaa_aaaaabaaabb``aabaacababa`aaba`b````````__`a`a```````aabbbbbcaa`bbbbbabcdbcbcbabaacbbccbcccbccbbccbccbcbeddecedeeddcecedbddddeccdcddddfecceededeeeddddeedeeededeeededeedfffeeeeecdddeeeddedfdeededdeddecdcfefedddddceddcbcccbbbcdbbbdabaa`aaaaaacb_grussoligcbaaa^^`ev̪xskllosx|~¾eNOMNNNNPQPNOPOQNMNNPUcjiggfb_^]]]YZWWWXWYXWWVUVWWXWWXVTUWURSU^bcb^]ZZXTTTTSSRQURRSRRQRTSTSRRTRTRSQV\`^XOIGHFDEEDDFGEFHFDDEHMHJKIGFHKHIIOOQNLJNTXY[]Z[\[^d_\ZTURNPRTWVUPMOMNONOOPMMNQX^]_ca_Y[\YITQMQXTUTTUSUSRSUTVWUUWUUVUW[dlkiifhecc`a\UV^il]OJIK[w{xvutrrrsvuuttstvvsoouwwtnd[TRNE<9?BTkwofp~zxvvuusrronlllkkkliihfeec[SJBA@=99><:9:75676436674565576568BGEEEEEEDDCBDCCBABDCBDADCCCDBDCDDFDDDDFFFEFEGFCCB@B@A@A?>?????>==:;<:::988765454554431122110000-/0////000`_aaa_aaaa`aa```aa__`aaaaabababaabaaa`baab`a`aabbaaabaaaaabaaa`a`aa`a`a`a``baaaba`bbbabccbbacbaacbccbabbaaaccadbccaacbaa`dcbcbbcceddceecccceegddddedddedeeeeedceddddfefedfdedeefeefeefefeefefefeedfddedefeeedfdeeeefddeedeeeedfdecddddeeeeddeeeededcdddbccccbdcaadba`abaabbba`_fsvssokgfdcbbb__crɥ}xpqqpqotvx{ɹ[QOONONORRPQRQPNOPPONUcjigddab__^\YWYXWVVUVVVUWWWVVVXVVVUUTSUU\bb_\\\WVVVWSRRSSTRRQRTRSTSRSRURTRSTSW]a_XNJGGEDEEEEFEHECCEDELHFIIJKLPNKMKOSJ@AFTZ`ffc]^`_abb_\VZ]ZSRVTX\XVTYJDLOPNOQPPXbe_[c^RNMMR[WSMQQUTUWTUTSSSUUVUUVVVWVX\gljijifeb^]^\WV_ljXJIFHUr~{yxsqprstuutqssuutqostttoh^VRPL?;>CPgwqgn|~|xxwvtttqoomnklkjjiihgefd]TJB??><;;:;866665757655654656544:@EEGDHEECDBDCCBDCBACBBBCCDDDDDCDDEDDEGFFGGHFGECABAAABBBA@@??===<<<:;;9;986665543434331022110///.../..-./.aaa__`a_`aa`a`a`_`aa_baababbcbabcbb`bbbab`cbdabbbbbb`bcabbbcbaab`bbaa`aaabbaaa`abcbccbccbdadbbcbcbbbbccacbcdbacbccbbdadcccacdaccddceeddedddcfedddeccecececfdecedfeeeeddfddeceedeeedddefedeedffeffgeeedeeedeeedddeddeeeddeeefedeeceeccfegddeededddecdeaddbccbccbccbb`baccaaadabbgqvtsqlhgdbbbb``d~Ġ}uoqvw}zz{}½ſĦuSQQOOONOPRSVSTROPNOOLUekihfecb_^\ZZYXXWWWVXWVVWVWWWWWXXWWUUTTV]cb_][YYWVVVSRSRSTSSSSSRSUTTTSTRTRTSWW``_XMJHFHEFDGFGGEDCGIEMHIIHJIINJIHJHHICGMTY_^]VTTY]^\[X][W\WPX_c^\[^aa_d[TPRQRPPPZfff[^`DXWMRUTUY_ZTSWTSVVTVUVTWUWWXWVVY]gmijhhfd_YW[ZVU[ieVKIHHQi{}}}zvsqssutusqonosstrrrrnmjcXROMA<?=99;9756556646666755;665547:CEGDGEEFDEEBDCCCBABBACCABBCCACBDDEEEFGEGHIHGHDCBCCDCDDCBBC@>==<<<<<;::;:7686544433453001001000//./..-.../bb`babaaaabaabaaababbbbcbcbcbbcbbbcbbbccdcaccbdbbcbccbacacbbdbbcbbbabcabbbcabbabbdeccccddcccacdddddcbddecdccdddeedddeecccdcdecededeefegefeffeedfedfeedffefffeegffeeffgfeeffgfgegefefffhgffffggfegefeffffgggefffffefeffggfeffeffecdfecghfhfeeefefeeeccdddeddcdccdcdabccdccbbcdbciswusqnihdaca`]`iž}ztssw|}|y}¾úļbQRSPQQQORQUVUSRQPOOMLVfkhgdcdc`]^_ZYYZYYWXWUXUVWWXYWXYXYTVTTTV]b`_^\[ZXWVUSTSSSUUTRSSTRSUUTSUSTRSUUW_c_WPHGHHEEGGFEEEGFGEIMGKMLLKPROLFHFDMW\]`c`]`bdhga_]WYXXZZ[dgfa^db[[^_`\ZWVZ]ZYW[^^b\W\B`[XVYVOT[c`ZTSTWWVUVUVWVWWWWWXZ^hnljhihd]USXWWUX_\TMIIIMasuuy|wuruuwvwurqkjnsrqqpqpmhd[SQNE<>@I_wvjiy|yywvvsrrqonnmllljjihhgfa_UJE??>:::;:677968765766667865668>BKGFFDDECEDEDDDCEDCBDCBBABBACBBCCDFFFGIIHIHHHEDEFDDCEDCEBA><;;<;;<9;99:87766554433433112121/01/.//.././//baaaababaabbabbaabbbccbcbbccbbcbbccbcbbccbaddcbbcbbbcbcdccecbcdbcccdbbbbccaabaccdcbdddecebecbcdbccdddddddeddcbecdceddcdeddedecedefeeeeefdeefeedfefffeefeffeffffgfefffgfgffeffgfgffffffhfffgfffegeggefgffedgfgffefefegeffeffgfgdfdedeefgghefeeeefeeeddddddcdeccccdccccdccbbcaccbhrussrlifebca```nμ}ywuuuxxwv~÷}VPNPRSRTQRRTUUSPNPQOOLVfljgefda`__^][YZYWXWVUYWVVWWYVWYVYXUUTSV\ba^\\[ZWVVTUSUUSQTRVSUSSUTVSUTUTUUUVX^c^VPJJEGGFHFDGFEEGHFONLLJGGGQLIGKQNT[[bec\bikba_Y_e^^QNY_bikbbmmbZ\YUX_gc[^][YVUSUURPQPCWQSP[YSJLUW^XUVWVVVWXWWWWWXWYWX`hniiigge]TSSTUUVVVQOJIIKZnnlq|}xuvwtvwwtqlgjqqpporrmid\TUUMA=>E\tykjx|zyxwuttqsnponlnkkkjjhggb^TLD@>><=;8:768878656656645534455=DGGHFFFFEEEEEDDCDDCCCBBCBBBAAABCCDEHHIIJIGGGFFEFGFDDEEFECA=<;;<<<;;::98867655554444320021100/0/.---..///.aaaaabbbaaaaba`baabaacbbbbcbcccccaccacbcbbadbbbbcccbbbcdacccabdcbbcadcbcacbacbccdbdbecdbccccdddcddecdddeeceedddeedcddeddccdedcfededdededeefefdfeedfefeeedfeedfeffefffffgcfgffeggeffeggdefggfhgfggfgffegffeeeefffeffffffffffffeeceeedeefffffeeeedeeedeeecdddceddcdbdbccbccbdbdcbhrvurrmkieeceabbr|xxwwwuxwwþeOOPPNSSTSRRSTSQROOQONOXfkihgdba`aaa^]ZZXWWWWVXYWVVWWYWWVWWUUTTX]``^]\YYWXVTUSUUSSTSTSSTSUSSSTTUUUSTVX_b_VNIHGFFFGDHMLOPHGJMFEHJKMNPILYYPSZeedebgg`QQ]gidXSTR]edc^\iq`VXXXYedaUUUY_a[ZXY]``_`UKWUUHSQTNJHUPTQPOQVWWWWVWXYVUXXY`jmjjhhgf^URRPQTVUTQOKJIKVjlkp}{wwtsuwwssoihkllmputnje\SW]WF?>BWqzlhu}}{xxvttsqrnnnnnlkkkjhigd^VLCA=>;<;;;866897556656666874655=DFEEEFEDEEEDDDBADCCABBAAABAABBCBBCFEHHKJJIHHFEGHFDCCGFGEA@==;<;;:;;9:88677544554434301100110/.0..//-.-/00baaa`aac`bccaaccbbcbcbcdbbcccbcccbcbbcbbdbdbbccdccddbccccccccccdcbcdddcbddbccbddedcdcdddcdccdececebdddcdeeecdedededcceddeddeddeffefeeffffeefffffeefffffdeeeffeedfffefgfegggfghefgeehfghgfffffgggeggggeffgffggegfeffegffegffgeeeeeeffeegggfeeffffegedecdedcdddddeddddccdcddbcccchrvutqnjhgccbaaau~zyz|xuuz¾ǿULNPORSSUSRSSRSSPRQPOOQYhmihgfedab__^^]ZYWWXXXYXVVXWXXZXWXUTUUTV^b`^][[YWVVTUTRSSSSRRTSSSSSRTTUSTSUVUY_c_UNJIGGHIJPQKKINOLMLNMJNLPROTa`PQccacfce_SRXhmf`][UUX[^\]eodZ\WTblnYN]XXblcTVa``^Z[[ZPNYVP@LLPJNNF>>RQHBHOTWXXXVYWXXYZ_jlkhhhhe`XQPMMUWWTRPLKIFTiomozzxtpqxwtsrmhhffinsxtlg]SUa`NB>@Rmzphu|}|yxvvvqpponnnnmlkjjihgd_ULC?@>>><::866766666665445566225>=<<;;;;99:8676545354444220122011/00/--..-../.0bbaaabbbabaabbbccbbebbbcbcdccbbcccddcdbdbcdcddcbccbbdcbccccddbcdcdddcedbdbdddbeeeeddeeddddddcddddeedfdddddfdeddeeefceeecedeefeefeeffgfeeffeeeffgeffgfggffffffgggfefhgfggfgfffffgegehifghgfgggfggfgggfhgggffffhffffgffghghgeefedegeffehgiggfgffeffgfeeeceeedeedcddddbddddeddeddcisxusqmkgedbdbcbu{{{~{zx}ǻgONNOQORTTTSTQRTQQQRSQQRYinlhhggfdca`^^\]ZYXY[XXXVWXWXX[YXWUTSTSW]a``\ZZXXUUUSSRSRRSRSUUSRTSSTSTTTVTVUX`a^UOIIIGHEPQJIGLNRQXVMMMRX^OW]UFLid^fhha^SYckg^Z[ZQQUY\[[lr][eZ]liYKP`[\ejZVW\UWY]a`_^MFFFI@HPQQRUKLNOMLQKHKPVYZXYWWYW\ajmkiiihgf`ZPJKQVUXTQNMJIPcommu~zupqwzuvsniha]dimtwoi_VR_gYH@?Kg{qis}{|zyvvustrooonmmlllkigfd_XMD??><=8;9677656656565565556445;EHEFHFDGEDDBBCABCACABACBBBBB@BBCCCCGFHIKLKJGEFEFDDDDBDBA??;==<<:9:88977546454533322200111000/0/.---....//baabbbabbacababcbcbdddbdccdcbcbcbdccbcccdcdcbccbddccbcdcccdcccddecccdcdbcbccdeecdcddcededddededdddefdecddeeddcedeefeedeeeeddeeffffffeggefeffgefffeffgfgfegfffgffffgehffffgffffgghfhhgghfegfggffgggfgggghffghfgggggghfggggfgfgfefffefgfhhghgffffffgfedfdeeeddedeededdddddeeddcdejtvwtrmkhgdbbadbu}y|~{}þʼ~XNRNPPSQQTRTRRTRQSRSRQRS[kqkgiffgfdbb_^]\[YYW[XYYWWWWXYZXXXXTTUTX^a`_[ZYXVURUTTSTSSSSSSRVRTSUUTUUTTTTUX_b_VMKIHGHGOPLMMPSLQ^SJQX[XNT_QDRja\idcbbZ^fhd\bYTKOZeecdsnY^bW_c]YPZ[[giYRVWRV_a^]XMLRGLVRUMOSRSQNPSRURLS\WUSMQXX[[YZX]clokiihhefhdUGFNUVWUPOKJIM`pmkoz|ytpx}xyvpmf]W_hdejolbWRYhbMB?Iczsiq||{yvvussrooonnmnlkjjghd_VMFA?>@>998876866555675565464757>DIHEEGFCEEDCBDBABB@AAAABAAAAAABBCDCCFFHIKIHFDCCCDDCCCCA@?=<;=;:;;:9987765545633333100212010/01.---..../0/babaabbabababccabccbdbdcdcbccecddcdcdccdcccbedcddbcbcccdccccdcbccddcdddcdbeddeededededcdeedeecdedfdddedeeeedcfededeededeeedeeeffeffffffffffgeffffffffgfffgfffffggfefffgfgfggeffgggfhhfgggghfffgfgfefgfefggffggfgfgfffggfgfffffeefegfeffhggffgffgfggdeeefeefeedddddddddfefededddjtxtuqmjigfdbcabr}{{y{}~¼mTMONONQQSUSRTRTSTTRSRRPR^mqkjigfdefc`__]_^YYYZXYYXXZYXZYZ[ZXUUSSV]b`^[ZZXWTUTTTTSTSSTTRSTSRSSSVSSUTWVU[_c]UMKHGHHFIPKKY`YVfRLUZ_[SZZIBWfcdedae]W`cjfcm^OQZcgd[^o`\aa[]^_VTXTaiZPW[PUefTIHOY]_WFLWNZWQZd[Pdjne^YVQUTMSOPWWVZ[Z[\bkmkkiigfgjh`LDMXXVPIOMIHL\qqlkv|uqw|{xuoh^X`f`ZX[ebYPSbeVIAF_wujp~|{|ywvvtsqpononmllkkkiee^WMFA@>>=9:;867888646656545565446>EGGGFFGDDDDDDCCDBBBAAABB@AA@AAAACABCDFGEGGEDBAACCBB@A@?>>===<<;::98876755655443433201012200/00.--......-.baacbbbcbbcccdccbcdededcdceccccddeeddcecdddfcdfcefcfbecdcececddcdededededdefffeffgddfedfddeeeeedfeeeefeeefeeefefffeeedffeeefffgfeggghfffffggfggghfhffffggfgggghhfghhhhhgghghhhhighhhggghghfhhhfifhgghhhghhghggfhghhhhghghffffgffffffghgggggghgggfgffdeffgfffgdeeeefegeefeefdeecjvxwurpjhffcdeacn~|z}|ûcMMPNPNPTUVPTSSUUTTSSTSTW`nolhhgggedba```a_]YZ[[YZYZZ\[\]\^]YVUSSU\a`]][XXWVTVTVSTSRSUTSRSURUUVVTTUUWVX[ab[UNJIHIJGFEXmnedgWK[cddR\SQERd`icebhd\]]fjek_JTcgbaW^nUY_[[\feUXY\j`LNURUbdREK^ffaUPZNXXU^[Yba[`g_aXSTUY[^ZTKBKYXWXYZ_dknnijihfhilfYPPXYWMFMOJIJYpumisxtz~~|vqkb[af^XLJNURJMZgZLFDWuxjn}|{ywwvusrpooomlmllljhhd_XKD@>>><;98566556654554443664347>DHFGHDGEEEDEDCDDDCCCCDCAA@BBBBABAAAACBBBFECCAAAACBBB@A>>===;<;;99:::887766564444540113232100000...-/./.0/cdcbdcbccbcbccccdcdeedededdecdeedfdbeedddddddeeddceefeeeecdeedeedddfefeedeffffgffgggdeefeeeeeefeeefeeeeegeedfffeeeeffffefffgfgffggggfgghhhfhfgggggghghghghhhggfhghfggfhhghhhhghhihhhghghhgghhhhgggihihhhgghghighhhhggghiffggffgffhghghhiihhghhhhggfggggefgffeeefffeeefefffdeeeemtwwusoiigfeecdbhȰbNLPMOPQSTTQTSUUTSTSTUWWYanpljhihfhecdb__a__]^\YZ\Z\\_^[]^`][XVUTW_a^]\\XXXVTSTTSSSSTRTSRVUSVWUUUTUUVWX[bb[SNJHIHIGC]og]cqcVamh_YZT[QS_bd_a[X^ba`mmifUJZgd`a]giV]]Z^bi]PU]e_QQMNQghQANdkge\TXggTJOZ`[b[[_b_ZXX[`[ZZVX\XMOKTTY^\\`hgillkkifkole^VW[XMGJOLKKUoyojr|vzxtnc^dh\XOBAHD=@Qb\LEBTrxln~}|{yzwutsroppnnnmnlkjhhe_XLC@>>>=<;<866766566556646665446AGGFGGEFEEDEEEDEEECCBCDBCAABBABAABAABDAABBCBA@@ABA@BD@??>>>=<=;;;::99877666665534431212132110000//.//0000/ddccebcdcdccdecffddedeefcdeddfeffceeedfededeeefeefcecddfefdeeddfdedcdefeeeggggfgefegfffffefefeegfeefegfefffeffeeeffffgfgffghgfhfgggigfhfhfgfgghfhigghhghhhhhhghhhgihhgfhhihihiiijhhhihhggihgghghghghghhghgihghhghghghggggggegfggghhgggihiighhhhgggggfggehfgdefddeffffeeffefgedejvyvvtojjhgdbddbdwƿ}}bNLNMQORTQTTSTTRTURTVVXUValpmkkjhigeebcb`cdb^^][Z\\\]^]\]`]]]YWUUX^a^][ZYXXVWTUTTRSSRTSSTUSUUTVUXUTWWWW\bb_SJLIGHEJ^nj[evoXall]T^_XVP_bda_X[[^aamiibKL^dba_]dZT^Z\bcbWPW`\NMPKMbp[=I_hg^ZUbjoi^OKSh`cjV\`^Z`c_]XXMFE>FMIEIJNSVQLOOOQYZSZabhpojf[UY[SJKPMJIRk{rmo}yz~tog`di^[UD@DB;>KZYKDBMmyln{||zzwvvtsppqqpnlllljjhfaXNFA?>>>>:9:87765766674334644478AEGHFEHFEFEECDECEDACCCCBAB@AABAA@AAAAAA@AA@?@A@@ABACB@?@>>>===;;<:9:886675556554544221221110000/././0//0./dcdcbccdcdeccddddedfeedceeecfddfdedeceeeeeffeefecdcfffdfedefdfedceffeeeffgfgfffgffgfhgfgegefgfeedfeefeffedeeffgefffggeffgghfhffggghhhgfhfhhhghhhghhhghhhhgghhhhhhghhggihghiijhhihkhihhhhighgghhghhhhiihihhhhhhhhhhgihhfggfgfgfghghgghfihhghhhghggehfeffgfdegfgeefeefeeefedegdffktxwtunkjgegeeccbh~}~~dOONLRPSSTSUUSUTTVUSUVUUVaoookkkjiiheccc`dec^`_]]][^\[[[\^]]\ZYVUX_b_]\\YXXVVTVTUTSRSTSSUUUUUSUUUVTVWUX]bc\TMLGIGH`id_duuZbpd\S^d^LIaeaa]Z\^]cafagdLTdbacbZ_YWa\```[PP_YMRLIL\ldF?XadZWXZacbd^ZXVdh]g`Z_[`a^\]WOJD?CJQQNPFEHLFLTZTORORRRSSRZfjd]W[_]QNQNKINf~yqo~~{{xrkbfj`^YI@GJGMVXUKEDJgznmz}}|{zvwutrpqpronnlmkiihfaXNG@?@>>>;:997686;7677554566357:BFGFGEGFGEFEECDEDCCCCBBCBBAA@AAAAAABAAA@AAA?@@@?A@?AA??>=>>=<<;;:::88866765555555431222121111001.//./././.ddccbdccbcbcddedeedededeceddeeefedfeefcedfddeeddeeeedcefeedefffeeeeedffffffhggffgfefffgfgfgfffgfffefeffeeffeeeffgfefegggffggghhggffhhghghgihggfgghhghghhhghhfhghhhghihghhhggihgiihhgghiigghhhgiifhhggghighghhgigfhgihgfggfgghhhhggfehhhgiihhggifghgggggfggeeedfefedgffeegeffdedjuxwusnljgefebecccpv}~~}}~jPMONQSQPTQRTUTUUTUTUVTUUbprollkijjidfddaeeea___^_^][Z\[X\ZYZYXVUZ_`_]\[ZZXWVSUTUSSRRUTUUSRTTTTSWUVSTVX]ca\TMJIIDcdW[e|lS^of\RW^[LB[i_^TX]X\bbhfkcL`jb`haNZ]\S_c]]^^]]KMSJCPhoW;G`aaXU[^^QTVNORW]YafkX\^gcedYXSJGQV^c`c\XVPPPAKPNJFGFCFLJQVQOU]]Y[a_\[XRKHMb}}tp{||ztlbcka^_NBGLN[\YTLEDHbxokx~~|{zxvvttqrrpqmnmmljihd`XMFA?@=><;989;656766555475445559ADFIGEFFFFGFDDCEDDCBDDCBBBBA@BCBAAABAAAA@@?A@A@?@@AA@>>>>><;=<;:999998766554664444103221211110000-.//...//ecedcdcddceededfefeeedffeefeefeffeefefedfffffeeefeeefeeecffgfdegdffffffggggfggfhfgggggghggfgggefhfegggffhffgffeegfgffhhghhghighhhhiggighihfhghhhiihhihhhhihhhhhgihhihhhhiihhikjihjiijhihhhhihighjhghihghhjhhghhihihfhghhfghgiihhhhghhiiiigihhihhhhjhggfgfffggfegfgfggfggfffgegekuyvutqlihhfffebdegtq{~~}~|~~}oQMQPORPSRPRTVTWUUUVUWWVXcrtnnpkihiiijhfececeb`^`a_`][[[[ZYZZZZXUY^_^]\\[ZXXWVUTSTUSTUTUTTUUTUWTWVVVWWV^ca\TLJLIXt`_d{v_ZgkUIQ^]PGW^TZW[_W[aaiehaDekbaj\O`cbNY_XZ[_`VRYSGEZjjPBYgcaXRZ^e[]e[]`R\]WhmcVWbc[daY[JL\b`Va_^c_QOILQNFCBDIPPPNPPOTWRGOY_eifgaXNJK^|vox~{tj`cke^`TEKNR_^TVPGDG_vojw~}{xyvvvtrrrpoomnnkkigebYMDA?>==968;9868577643439654665:AGHGFEEDDFDECCDDDDDDEDDBCBABBCCABA@@BAAA@@@?@@A@@?@@?>>>>>==<<;;:::98867765645656342223122131101/.//./.../eefdeecdcdedefgeefeedfeedgffefeeedfdeffeeecgffeffdfeeffefefffgfffeffffggfhgghfhgfffgfgfhfghgghghfggfgfgfeggfggfhffgfhffhhhhiigigghhhjihhhhhihhggihghghhhhhihhiihhhihhihhhjiijhihigihhijhhiihhhhihiiigjhhhiihiihhhhgiggfhhfhihhihihihhhihiiihhhhhhhhhghgggdhgegfefgghgffgfffgfffmuywvuqnjggfeedbcccdu|ry{{}sSMPNMNSOQRUVUVXWUWWUWWUYertrqonkkkjjjifedgedccacbaa^^]]]^ZYWZYXVY_a^]\ZXWYWXUVTTTTUVSSTUUTSTUWVVVUVWVW_cb\RLJRPr^\Ylwp[oyhPM``TNTbaXVZcXY]eojb\B`f`en]Qa_]T^]VRXc[PYZJNR_mjPI`fffZRV`cb[b^^e^MY_]jhXX`g`bd]fIMa`ZZXX_\SIJTWUSPIJNOOHMOTSYWSVSPQLP]gkrn_PIHXw{ou~~}yrg[\lf`d[JMPR\]QSPJHEXsqkt}|||zwwuttrrqonnmlmkjhf_XOGB?>>=88799888666565476533666;AGGEEEEEDDDFEBDEDDDECCBBBBBCDBBCBAABAAAA@@A???@??@??>>>><<=<<<;;9:8888766555566543121223213110020...///..0fefgfefdeeegegefffgfgfgffghggeffehffgfffffgfgggffffggggfggefffgefggighghghhhghihigiigighhhighigiiigfghgghhgghgigghfgghhiihhihihhhghhhiiikiiihhiiiiijihgihjiigjjjiiijjhiijijjiijkikiiiiiiijiiiiiiijiijjhjjjhikhiihijhihhiiihiiiiijhhijjjlikijiihhihihifgghggggfghgfgighhgghggeggmwzxvtrmihggffc`cbbbh~szy~|{~tSQOQOSSRQQTUXTWVXZVUWWXZhstrrqnllkiihhghgghebaaece`^a``]_\Z[YYZVZ_b]]\[ZYXYWWUUTSUTTTSTUTUUSVWWTUVVWXX_db[TLPVZeU]`xuiexpSL[eZQP^`c]_d\ZWkqj`YB]g_hhWYb[YW`[RO^cPN^PFPOcl_HReeceZUTY]a]]`gli^K]]ccaSXejgf`bXHb_]]__\PMIS[[RJMJLPMOLOSSQQRXWWZWTVSP]dipfUKITp}nr}~zsfZZkg^faKLPPX\PRUKIFTqrku~}{yxwwuttsqponmmnkihe`YNFA?=@>;:69:9777666665:6865477=CEFEFGFFEFDFEBDDFEDFDDCBBDBCBBBABBAA@A@AA@@AA@?@>?@>?>>>><===<;::8:99886677656664212222222221112.//./././0ghgfffefeeeffffffffgdgfgffgfeeffeffffffegffggeffffghgifgfgghgggfghghgihghggihhhhhihhhhigihghhghgihggihghhhghfgggigghhijgghiiihiihijjhhihihijggiiihhhjihjiiijjjhgiijhiiikijkjjkjjjiikiiiijijiiihhihjfjjkjijijhiijiihhjihhhihikgihhiijhijijhiiiijiihiighihhhgghhghhhhhghhihhghfhfkuzwvuqmkihgfebbbcabakzv~}~wSQPNQPRPSQSUWUXW[XYYWWXYfuusrollllhhhhhgggfgd`adcdb``___]^\XXZYX[`b^]][\ZZWWVVUUUTTUUTSUTSUWVUVVUYVVVZ`ccZSOV^`S_alvm\urXLZdeVTZaeb`kb`Wjok^YE\faidT[]WZS^XKOaYKV[FHXOcmWCYdcacYRT]abdbZaffeZT]c]beL[qmde\_G][V^_\]UHP[[PMSXRLLLOUTPORXVLPQUSOOPQSKUbniXKJNfxmq}{zwtiZZkkahePLOPV\ROVOIFNjrlt~}|{zwwvvstsppqonokmihfaXMG@A@?>=<899966675655876553556@???@>??@?@>>>=?=<<<;;;;;::898876777656643212222221131012///..///00fgdgfgefggghggfgfhffgffffgfhfgfffgeggefhfgfffegefffgfgfgffeffhgffggggghhgghhhhhhhifhihgihhigghghghjihhhgghghggghhhgghhhhiihhhhhhhijghhjhiihhjjijihhhhiigjhiihhijkjiiihjijjijljiihihijkiijihjigijiijiijhiiihihijjjiihhihifjjiijiiiiiiihkkjkkjihjiiiiiiihghhggghhhfiighghhhhghhhfku{xwuqmkigfgfdfeeeb`ar{zyVPMPOQQQTTUXWXYZYYXZYXYZfttrqmmlkkiihhhgeehhedcedeb_``aa``\[[XWY[aa^]\[YYYWWWVUTTVUVUWVTVWUSUTUWVWVTUZ_daZOTV^[Si_oqdiue?ZaeeTYfbi\ihdXlpm\WHZ__k`T`ZVSZ_WLU_TL^[IS[ShcPB``\]_QMRX]^abaac`_cZQZbVfdOfnjch_LPfP^jbb]OX]UINWYX[RPPOSXMKNNNMRSRSKMJHOVQQam]NHL_vqjn}y~qkjj_WcfaijXKMNS^TMVRKFHerls~~|zyxvustsqpoonommjifaWNDA>>>>>:8:8:765669=6447544467>EDGGGHFEFGDDFECDGFDDEDDCCBDBDBBBBABA@ABA@@@A???>>====>>=<<<;:;:::9989977786666553012222213220012/.////////gfgggegghghihhhghfgghgghhfggfggfgfggggfgghggfgggfhfhgggfghhfhggfhghihhgihihiihkihhhhijhhhihhiiihhjiiiijhhhhhhhiighiijiijijhiijkjihjijjhjiikjikkjkiijikjiijjjkjjjjjjiilikkklilijijjjijjkjjkkikijikjijjijjijiikiijjiikhjhiijhiihijiiijhjjklikkjjhjiigjhiihhghighhkhhihiihgihhhghhmvzzwtrmkiggggfgedfcc`fWONRPORRSVVXXZ\^\[Y[ZYY[frsrrmnmkjjjhhhhggjheeeeegc``a`a_^][YWXWZ`__]]ZWXWXWWVUTUWTTUVTVXVUVVXVVVWWUVY`eb\QZPc^`d`pmdmmGGbhgXR]aldcfdSfmmcUHXa`jgY_ZTXW`YRZaONaSK[\Td]ED_```aVIVced__^`ca`chZ]^_Tl^UghfijcF`YW_gc`WVZTKQXTSPX\WQOVVPLKNVPOTQVZWPQOLXVZc_QJJXmqkn~{na]^ULOVYhpbQNNWbZKRTOHGdsnr~}}zxwwvuutsorpnnmjjifaXLFDA@??>998:777785545444543468=CEEEFFEEEGEFFFEDEDCCDDCCCBCBADAACAAA@@?>A@A@@?>?>>=>=>=;;;<;;;;::::99987677656662132131222110121/////.///0fgffffgffghghiighhghffggggffhfhfgiegggffgggghhgffgghggghhhhfgggfgihihhhighhiihiihihhihjijhhiihhijhhhijhjiiihhhhhhijjjjihihiiiiijjikiijiiikjijjijiijjkijijikjijjjiijkjjkkkkjjjihjhkjkjkikiikjljijihkjkjjjijijkjijjijiijiijijjjjjjjhkiiiljkjlijjjjiiiihhhhghigiijhiihhhghjjhhihhhmx|zwurnkihgggfddfeddccl||VOPOSPRRUUWVTVZ[[YYZYY[[hstrrollnlkkijhihihhihhehidba`b`^]`ZXXVV[_`_]\Z[YXWWWUWWVUUTUUSTTVUVWVWVXXYVWXad`\OSU`gbU]hgckU9[pf]VQ_cidgeU_qjgYIW_dsj]ZVV]X_WT[^PTcRR]\T\XHHklec_TLVa```aSX]]efgfX]`Z]k[ZiebjgUN_Rha`gZWYTRaTJOTYTSUTOQVNLSXNIFMLPPWTRLMNSW\[VLITflkn}~|q`RMB=>ESgtkXON\j_JLOPHF`qms}~|ywxvuttsqpoollkiifbVLIBA@DFEEDEEFEHFDFFDDDECDDCCCDABBCBBBBB@A@A???A?@?>??>>>>>===>=;;;;:<:;:99::6666765642022122121220210./../././.gggggffghhhhijhhhhhhhgihgighgfgggghggfggggfhggghhgghhghfgggghgghghgihhjghhighigiihiigiijhjhhhhhiihhijgjiiihijhhiiijikhihjhjijijjikhijhijjihiiijiijjjhjijiikjkhjhjilkkjlkjkkjjjjijkjikiijikjjjkjiikjjljjiiijjiijiiikjjjjjijijiijihjiijkjkkkkkjjjiiijiighiihihihhigihjkghjhghihhgmwzxvvsmkihihgffdeddddeew}~VPRQQQSTUSXWWVUVWWWXXWZZhsqrrnllljjiiihghejkiihghfbd_ada_``[WXUU[b__]]\\ZXWWWUUWVSTTVVTSUUWVVWUVXXXWVZaebVKQXdjdZXiaf^KEbk]iOV^edga`UornXIR\ask`[RP]Z^XW\ZNT[OYWZPR[PDjnmkeVLO_[]bkdJVY`diedVZdR]l^_mjciaK_Wai]haO_XZaWOQWWXYWSPQRVPVSILMSRNMNORXVQMNLPSTOIReljjx||vcQD;8DFGFFEGFGIFDEFDCDDDCDDDDCBCBBBDABAAAAAA@?@@@?A?>>>?>=<===<;;;;;:::;:9:87666666641121121232101110...///.///ggggghhiihhigihhhiijhhhhiihghghghgfighhhghhggighfhhhgighghhgghhgiiihhjhjiiihiijihhihhhiijjijiikhjjjiikihijiiijjhjjijjjjijjjkjikikijjjjkhkjjkkjjijijjjjjjkijkijjijljjklljlkkjjjjikikikkkjjjjjjjjkjhijkjkjkkjjkjhikjjkjjjjjjkijijjikkijjklljkkkjljjiiijgighihjijihhiijiiiiijjhhhjnv{xwtsokjijhehhfdfffafdk~VRQSPRTWTTSTUSTVUWWWXWYZgsrpqnmomliihfggfghlmjiigdccbcedbec^ZXVW[b`^]\]\ZWWVWUVUVVUTUVUSUVUTVVVWUWXVVZbdaSQO\m`S_ji_aI_E`bmbOZbchdbVernZMM_ixnf_UH[X[XX\VIPUH[TYVV`YC^c^\\UNKZaZ\_feEW^bdkghVZcNYh_clhhiUWhVlj_fQ`_T]RQ`]Z[`ZXVTRRWSQJORMNQTRTUWSV]XMMJPTOQRdpjmr}|wfUF;89>OdrsgZR\ibOHKLJBWmmr~}}zyyxwutvrqppnnmkie`VMDAB@@>=<;;9876644766454555468AGHGEFEFGFIHEEFEEDCCDDDDEDEBBBABBCBAAAA@AAAA?>??@>>?>?>>=>=;<<;:<:::::788767765531222323322201210//.//.0///hhhhhhhhiijijiijjjhjjiiijiiihihgihgiihghhihfhhhhhghhhhhhiiijhigihiihkhkiijijjjiijijijjkjijijjijkijjjkijjjijjkjkjkjkjjkkkiljjjkljkjkjjllkkjikijjkikkjkkkjjkjkkkklkllllkklkklkkjjkkkkjjkkijkkkklkklkkjklljlkkkjkijkjkjjjkkjkjjkjjkjkijjkmkkllkkjjjjiijkjiiijijjjjiihkjkjijjjjiijhov{xvvtnlikkhhigfeeddcbbgvzhkZSRQRQTTUVVUUSUTVXUXWYWYerqppnmlmmiiggffceillkkid`bfeeffefc_]ZXY\cca^\][[XXWWUVUTVUTUUUUWTVVUVVXWWWWXZcc_XPQ]dU[^[^\JTZDOkt`Z\bdgebWso`SBblykj_TFSTZWXZ\PMRO^SZUXaQ=[a[XUULNS`[ceb_^EX_dehdeZZaQUicgohldJi_^megXUeW\SWcebaX_][YUXTXQMILNOKIIIKMQNMT\]TOKRTNM`rmjv}}}lYJ?:9?Napri_Z]gdRHLMKESins|}|xxxwuuussrpnomkhg_VJEBB@@>@=:;9:76766656576544566@FHGGFFEEFGGGFEGFFFEEEDCBDDCDCCDCAAAAAAAAAB@?>A?@?>?>?>>==<<<;;<;:;;::999786766532222213223123200.0//./0./0iihihiijjihhjhiiiijjkijjiiijikjjihihiijhijijihiiihikijjhhiihjiiijjijjkikkjjjjjjilikkjkkjkkijlljkjkkjjkkjjjjkkmlmkmkkjjkjkjkllkkkkkllkkkkkklkkklmlklkklllljkkklkkkmlmlmolllmllkklklkkmlkklkkkjkkkllmllkklkkllkkkkkllkljllllklklkklkmjjnmnlmlllkkkkjjjikkjkkkkkjkjlkkkjjkjlkjjkjjqx{zwusnmlkkijjgggefcdfedl|x]Yu~{z}|z{}VRTTSSTTSSTVVVXWVYYWXYXZhqrnlllmomljhhgggekjjkljfcdhggjhgeb`^[[Z\ba^]][\YWWWWVWVVUTVVVVUTUVWTUWTWUXYY]bc]VRS[VS_egi_Q[XN@kmUc[jnfn[jvgRC]n~ng^PCLSWU[YVQHKM_S\ZV`XF\a[XU]UNR`\UfecZ[HZ`ef`^^_XXTVjdjnhl\TiXhjbcP^Z_Y\hebef[\^\^UY\ZUMJNPQNPMIHGJONIM^`XRLRTGNosjr~}u]MA<<@L`oogb_bhgWLLNLFQgnq|}|{yxwvutttppnpmljg_VJIBA@A=>:;:9957986666575445347AGGGGHFGFDGGFGFEEDEGEDBBECDDCCDEDAABACBABAAAA@@A????>>?>>>==<<;;;;;9::98888878643332333332212331////.///0/0ijhjihjihjjijhjjjjkjihijjjijjjijiijiiijiiiihiiihhiihhiihjhijhhikijkiilkkkjjkjijjkkkkjjijikjijiijkkjjjjjilkkjjlkmllllljljkkklkjjkljjklllkllkkllkjkkkkkjjllklkmllllnlnmlklklllkkklmknlkkkllkklkkmklllkkllkkllklkkllkkkkllkkjkkkkkjklkllkonllmlkjjjjjjkjijjjkkjjljlkklkkllikkkkjjjowzywusomlkhihigghdceefdbcu}aZfnz}|||{sqw~|XRUTRRURSRTWWVW]YZ\[XY\Yersommomoljjjhiihhmjkmkkgefegihhgda^^^]\]`_]]\\[YWWUWVXVVVTVUUUVVVUWVWWWYWWWX]ccZURR]ZS^XLUXUPXRB`t_Y[vjnlZxqSAQlzqc^QJGSYV]XTPIBL]RYSK\\IYdYXZa]OP[cPZab]]TL]aedYR\^_VSTibimckOXa[kflTW[a^T_jhehbYZ\\\[[]\VNNPOQSSTPJFDINPMMW`XQIYVFVtqlz}~{bQD><>J]orhbbeik]OKNOHMcmq|}~|zwwwutssppommkif^TJEBAC@=?;9;<98779868764555445:CFFGIHIGHEGFFFEEEDEFEEDDFFCDDDDCCCDBDA@AAB?@?A@??A@???>>>=><=>;;;;::9:89898776732333332223202310/0//.///000jhiiiihjjhiijijjjkijjikjijjkikjijjkijihihjjijhiihiijiijhjijiiiiijhljijjkjjjkijjikikkkikkljkkjkkljkjkijjkjkmkllkklmlllmljlljlklllklklkllljjkljklkmllklklklllkkkkmknkllmmmkkkjkkkkllllmkkklmkklkljjlkkkjkkllkilkllkkmlkljkkkklljkklkkkjmmmomllklkkjkjkllklklkkjjjkljkljkjkjjkkikiowzzyvrqmkjkkiggihefeefecbmwytdlotv|zz{|xrt{XTUTRSRPRQUUW\\[XZ\\ZZXZgrsqnnppokhigiihjlnjjnmjigefdehji`a_`^]\]ba__[[[YXVXUUWVWUUUUTTVVVXWWXVWXYXVX\acecT`gcftg\QSYO[ZMHwaWbsivOlzVALhzoefXICQTX_ZTQP=MaUWUH]\MRj]SWWZSMN`WNa^_ZYMQ`cb`aULXfYRSickmegL^\adibO\^eR]fehhe\Y^]\]YXZXQRPQQRWSSSVSOIHJLQSQ\YSP[WI\rov}zvw|hSD@>=G\ouledfnpcSJOOII`lq|~}{yyxuvvsspqoomlje^TKDCACA?@<::89:77:8866644544439DEEEGHHGGHGGFFEGFDFFEGDDDECCDCDBCBDDDBCABBB@AAB??@??>?>>=>=>=<<<;;:99998898777532323323332211310/.////////0iihjijijjkjkjkjkjkikjkjkkjkkjkkjjkjkkjkijjjkhijjiijijihijjjjiijkjkjjjjkkkkkikjjlkkklkjkkkkklkjkjkjlkkkkjkkkmllmlklmlmklkkklkjjkjjkmllklklkmkmllllllllllmkklljllmnmonnmmkklmmkllmlmlklllkllmmmllkklllllmlmlkklmlllllkllkmkmlllllklkkklmmnnmlklkklklkjlkjklklkkkkljklljkmkllkkjjkow|zzuuqlkjkkiigghhhgfhffdfrttxq`ftv{~}zzyxxyzYSVSTUUTRUUWYZ][ZZ\[YZW[jstqspqmkjjhikjiknnllkkllhghgdfhe``aa^^[\ba^\]\[YXWWVWWWVUUSSUSVTTWWWXUWXXXWY^^bgYVg[VTTSVLT_[V]]GvbfmhqiOyeIAZyvfh`LCTXR\]WUYELg]XYI[^UMb[SQXVUGFUbOP__[SZMR`dec_^EUiURXkfghg]R`XfckTWZaXRjhfliaV`cb]YW[WSQVRTMMT\\[WY^WKGLITZNSYSU\aP\ut~wooo{oXI@>?DXnypfegothXMMQJJ]jq{~}}{yxwvwutsrommkid^SGDDBBAA?=:;;=:75:976776666664>>>><<<;;;8988887877753323332232310321000/0/00/./0ihjjjjjjkkijkikkkkkjjkkkkkkjkkjkjkjjkilkkjjikkljkljkjjkjjjijjjjklkkkllkkklkljllmklkkjlllkllkljkkklkljlllmklmmmkmmllmmnnmlnlkklkllmmklmllmljmlkllkllklmllkmmnmmonlnlmnmkllklknlllklmlmllmlmklllmkkmmmlmlmkmnnmllmklllkmmlkllllllmlmmmmnnoonnlknlmlkkklllklklkllklllklkmlkmlkljiiox}yxvusnkkjkhhhgggfhfefggblrhhbcgpv||z|y|]UUSSSSTSWYYZ[\^^\\\\YW]kstsropmkklhikiinmlmnlkkjjihidfge``_a`]Z]ab`]]\ZXZYXVVXWWTRSUUSVTTVVVVUUWXWVZ[`h_S_TPLLOLIINM`WO`T^cnrftWfsWHOmudicKHPYVT\ZSZPH`RTZLL_ZFZVNSRSTQBO]^LU`\SZVLT^bfdaaNLeXU[idgfhWWaT`jcO\_dSb`ilkfZWfd``XXWNRTTQNNPMQRY]SZ[]RJNIRWLI_PZ\kKeztqwv`LA>>CUn{tihgnwn]PNNLIWgr}~{zxwvtvtsqonnlke]QJECCCBB@;9;;<<97;8;86;7756676=DGGHIGGHGGGGHFFEEEEFGFDDDEFBEFECEDCCBCABBABABABA@@A??????>>=<><;;;;9999899888743323334233312321//.//0///000ijjjkjjkkklklkkkkjkkjlkkkkkklllklmlklkmkljklkjjjiiklklljjjjkklkllmlllklllllkkljlllmlmkllkllklllkllmlmkmmmmmmlmmmmnllnmmmmnlnnklmnkmlmllnmmmmmmnllmnmmnlmlmlmmnlonnnnnmnlnmmmnnlmmlnmlmmmmkmomlmnnlmllllmmlnnmmmmmnmmlmmmmlmmlnlmlnmnmnpnnnnonlllmlmlllmlmnmmmmlmmmmmlkmlllmlkikow}{ywuqmlljiihihggfhfgffgdjokkqmkkt}~{~|}\SRTWUSVWVZWZZ__]\\_]YW]mtsqrqolmmlhimklkljllllljikjieffe_^bb^]Z^aa`^^[[ZYZYXXYWWVVTVUWVVVWWWWZZWWWXV[hf`[eVTW^XYJGFMR_QVZYmplloPwrLL]sbbjNGJ[VV\XSTUI\MF[XG[\LSWNNOQVZKHZebN`bV^^VOO\eefbaWGbZVZ``ijhU]_PcpWU`l\_e_ikf`VYcabbWRPXRSRPOSUMLNJSSTZYZQPQIOVLP_OagkIv{fRDA@BSi}|phiozq^POOJEQdq|~|{zxwwvvssrponlif]RJFEDCA@?>;;<:;<;879<:97876678;FHFIHIHIJIHHGFFDFGFFIHGFEDEEEDFDBCDACCCCDDB@AABA?A@@@?>>>>?>>==;;=<:::8989777843444343332213221///0/0//0/00jjikjkkkkkmkkkkmjlkkllkkkkkjlkklkkkkkjjmkjkjjkljklkkkjlilkjjljmllllkkjllkklmlmllllljklllmllmmlllklmmlnlllmkmnmnmolmnmnmmnmmnlnllmlmlmllllnlmlmlmmklnlllommlonnnmoonnnonmmmmlkmmnmnlmmmnllnmkmmlmmmnmmllmnnmllmmnmlmmmllmknmllmmmmlnnnnnomnnmlnmlmmlmlmmlnlllkllllnlkllmllmllkjmoz}zzyurolklkjjjighgighgfhcfjmqwnij|~{uu~þ_UTTXXWWYXZZ\]^a`_^_][X_mssprrrmnnliklkiikkkmnjkjjmmkfeec_]^`_\[^ca_^_]ZXYXZXVXXWSWUWTUUVVVWVWXXWWXXR`ib`_iahgmql[\T9O^dNT^isfvc^URUsccdYJHZVY^TVP]E]VMSVKV\KL\PIQRXWSCM^cdK\VW``UPEZcih_[WFbXXXYZjobWgWTllP\gd^lb`ige]T_`^`WPRRSUUQSVTVOIRMFQYZZUPMUNJUYDZ\Z]j^ZmXHB??Qh{ujho{taRONJFObr|}zyywvvuusrpnolid]RHEEDAA@==;<;;8:8786;898965658=EGEGIJHHHGHHGGEFHGFGGEEEEFDEDDDCDCDABBCBCCBBAABAAAA@A?????>>==;<<;;<98998888763444344333333321//0/./.000000jkkikkkkkklkkklklkkkklklmjlkkllkkkkmllliklkllkkmjkjklljjkjjjkkllklklkkklllmlmljmkmlllkklnmllllkllmlmlllnmmnlmlmnlnmmmmmmmnnnnoollnllnmmmmlmlmnlllmommllnmmomnolomonopmolmmnnnmmlmmnnmllnmmlmmlmlnmnlmlnnmnnmlnmkmmnnmnnlnmnmmmnnnmnnnmpnnnnmkmmlmlnllmlmkmmmkmmmmllkmmommmkljlkpy|zywvspmkllkkiijhihghffigfgnxxqgt{st~±z}`RWUVZYYZWZ[]]_aa_^_`^\_muuttsrpqpmomljjjmkmqsmlnnrpmgfeba\]]`\\^ca_^^\]ZZZYWWVXWVVWTVVWWVVWXWVWXX[QUagd`gpnp`mvcfq{g4XdTBjgpi~UxgNUkiabfLJXUXcZWJWGLLKORKOWPJZUHWTU[^IF\babCTPX_`PJAZcfg``SD`X\WdYgk_WlTVp]Qced]gZbgf^YT_^]ZUWVOQTUVWWVXYLTMIMX^[ZSMO\OLTWHbU_[lTou`KB?@Mf}}mhpzueUQNJHN`r|||{zwxwvtsrropmic[QGDCCBA@><==>=;;:;;78988966666?IIHIIHHHHGFGHHEFGGFFEFDEFEEEDDDDDDDDBBDCCCBBBB@A@A@A@@@?>?>>>==;<;;;9:8788788444334433233234200///0////0000mmlmllklllmjmlmmlmlmllmkmljlljkkjkkmlkmlllmkkkkmlmmmjljkklmknmmmlllmlmllmlmnlmnllnmmmklmlkmlnmllmmmmlmnlmmnnooknnonmolmnoonnomnpmmmllmmlmllnlmnlnmlnlmmmllomnopnponnnomoommlnlmmnmmmkolllmnlmmmnmlnnmoonmnlnolnnlmnnllnlkonmmllllmmnonnnonnnpnnmkmmmmmmkmmmmlnmnnmmmnlmllmkkmjmpy|{xwvspnllkkkihihhhghegffgen{}vt~ytv~DzĺaXWVZ\\Z\XYX[^`_a__^]\\`pxxvutuprrppmmlkkponppnllouqkhffeb\\__]]bdb_\\]\YZWXWWWWXVVWUVVWWWVWWWVXZZZSZdf``mjfbYi`adtZDf^Djnkoy[}JT\nadg[GPXUcRXMMPHKLKSKQPXLYZKPUZbc_DRbbcX9SXabbN@>Yddc`aTD]V\Pd_em^XkR\pV[gf^`_Wbgb[]W_^YSPQVWVTYX\WUSYSVVGbTOU``^K[cKKSSNbPZ]hS}fOCA@LeslmyvfYQLIGJ]q}}|zzzxwvsrspqolieZPKEDCBAA?><<<<9;:;<:999555667:@JIIFIGIFGIGGGIGGGFGHGGEEFDDDDDFDCDDDCBDCBCCAAABBAAAA@@A????=>>=<<;;;;;89:977743454533323323320///0/0/000000lmlllnllllmmlmmlkllmmlmmnkmllmnnlklkmmmklklnmmmmklllnlmkllkmnommlmlmlllmmlnnlnmnlllmlnmlnmmmmnlnlnnomononoonomonnonomonnnnpnnmmnnplonnmnmnnlommmnlnnnmnnropoonmonnonnmolmpnnmnmmmnnnmmnnnlnlonnmmnnnnnnnonmnnonnnmmmnnmnomnnlnmmoooomnmnqpnnmnmnnmmmmmmnmmnlmmomlommmmmmmnnkmmkpx~|zxvrpnlmkkkjjkkkhgjghggffhu~{ʹż`Y\\^\^[[XYYZ\`_b__`^^^eryzyxvvrussppolnnpnnommlooqpgffhfa_]]]]]aca`]]Z\ZZXWXWVVWUVXVUUVVWWWWYXXXYYR[gdadneZc_]aacp{suR\_VmueynfaPVjaj^kLGXS_OUPJVJKULSMONOYP\RKW^__bSJ[ddb[;O\_bbP>DZadabeY?\UZJeabnZaiS`mScei^_W^`ge`ValgbYTNQY]WVVX]YTVXTTHWaUS_cecNdaMMZMWXYZ^VciSDBCKb}wlmxwgYSPKIJYn~~~{{zyvvusqrrpnjdZPGDDDDA@?>=;<<;<9;:<<98786656:?HJJIJIIJIJIHGFFGGGHHHHFGFDEEDDGDDDEFDDEBBDCCBABCBAAAA@@@?@?>>=>==;<;::::8:::6545554433332343000//00000/0100mmllmnmnnmmnmnlmklkmlmlklmlknjmlmmmnlknmnmmnmlllmlllllmnmknmmlmnnnmlnnmlmnmklmllmmmnmlkmlnmnlmmnnnlnnomnlnolonopononpoononnpnpnonppooonnnnmnoonnnnnnnonqpnonroppnqnppnmnnnnnnnoommnnnnomnmmonnnmnmnnonmoomnnnmnnmnmnnlmmnmmnnnoonpnnnoopoqononnnnnmmmnnnnmmmnnmnomomonmmmmmmlnmpy}{zxwsponmkkkkjkkkiihhghhghfk|®ǾbX\Z]__\[[\[]\_^^a`bacbhu|}yxwwwvurrpnpopoopqomlnrnjfhfjd_^]]]]^bca_^][[[[ZVWXXXWWVWWVUXVWYYXXXXWYVV]e^T_hd[KWYe[fuoryWFYajugalOV_egamXGQMZSPUDZJIMKIEJLFZPORLV[aeecLQ]a_^\7MZ[acRDL_ab]ab`?[UTLg`emXhkSf_Wfje_Y]ddcebPaba_]^ZSS[YYSQW[XRTTRQSQ`[^X_cUU`aLPVLcO[Y\D{nVEDBJ^z}novxjYQQMIIVn~~~|{yyxwvsrqrqnjd[PICDDB@?><<;>;<<><:89797777878BIHHIIIGHHIHIHEIHFGEHGFGHEFEFDDEEDDEDDBEDDCBCBCCBCAAAAA@@?@>>>=><<=<;;;;:9;:9655555444434334320/000000000010lnlnmnnnnlnnmnmnlmlmlkmllmllmllmlmnklmlllmmkkknllnkmllmmmmmnmpnmmonomlmmmmlnmmnlnmmmmnnmlmnmmmmnmnnnnomoomnnpnoonnnonoopnopopnppnnnqnoolnononnommnoponnooqpnonqopnnnnmpmnnnnnmnmnonnnnnnopmnoonmnoonrpnnnonmopnononooooomnnnoonnoonnnnoonnnopnoomnmnmmmnnmnmonnonmmnommmmmlmmloqz~{{xvrqmnnmlllkkkjhiihhhggggip¼¼úaZ_`]_a]^]]Z\]\__efbcddhw{zyyxwvusqqpomllmqsqoonnkgjjged^]]^]]]`c`^]]]]]YYXXWWUWWXVWWVXWWXXWYXYXZUY[cVXZNd_CO^[_gpmoofFThfqp{^bRVhaidkDOITWK^SNVGMMBGF@CQ^S^QPZ`_][REYdb_][7OY_[^LIWca_]Z^dFXSTNib^gWifPiRakjc``\kg_d`Tca\_[[ZXXRW]^RXWUMPSTS^SVV\WW[U]]^[IRIVWPYgFVs[GB@GYvpmuyl[UTPKHSl~~|zzxwvvtsrprojdZPJEDDB?>==<=>>::7;<9688977:9:<><<;<;<:;:;9886555544533332452100000000000001mmlmmmmmmmnlnnnnmnlmlnlmmmlllmmnmmlmlnlmmmmokmmmlllmmllnmmnnnmnnnmmmmonlnlmlmmlolmonmolmmmlmnlmloopommnoooponompnnnoonnnpnoonnnnnqonpmpnonnmmnlnnnoopnqqnoppoqnpnnlonnmnnnmnnmmmonmnnnnnmnmoommnnpnrnnmnnmnonnnnmnmnlmnomnnnonnoonnmnnoppppnononnmmnmnomomonooomnnmmmnolnnmmmlmq{}|zxusrnlnmlkkkkikjjkiiighihggjx½_[a``ba`^_^]^^`accdfffejw{{xyyvuuqrookijlmqoqommmkjjggec^]^]_]^bc`^]]]Z[YYXXXVVVWVWVWVVWTWWZXXWXZWUWc__ZcYUBNVZfkjorifJDc`oxw\VP^`g`qSHNQ^I\]LLHRNAPD?@KRRVRHT^a[UYHJb`]^^V>Wa`[_QMWf_c[W`gMUVWOnd]_UjcOcQeki][g_jc^bdUfd`a]VTRTVOY_[UXVQLPTVZ[\aY^TWVVea^UPPJZLRfhBzv]LB@DUpsntyn^USPKGRm~}{zxxvvusstrnibYNHDDCB@<>==<==<;;8<97988769789CHHHHHHHHHIHHGIGIIHFEGGFGHFEDDDFECEDDEDCDDDCCBCABCBBAAA@>@??>=<;><<<;<;:9::;665554653334334421/00/.000000101looonnnmmonnmononnonnmlmmmmnlmmlolnnmmmlmllnmnnlnllmmmonoooonnomnonoononnmmmnmnmlommmnmnmonnmonnoooooonppooooonpooponoopnopqoooqoopopppoqopnoopnonpnpopoppqpropoooponnpnnononpnononnnonononopooopqppopnoooonmpnnnnnpoomonnnpoponoonnnorppppqopnooporonpnnnnpoooonpnmnoomnmoonmms{}|zywtrqnmllljkkjkkkkiiihhghghfhnwvq¼aab`ab`bb`abbc`dcdgfhhfnz~zyyyxwurqqnmillmusrqnnljkhgeda_]]^^^]cca^^^]Z\XXXWXXWWWWWWUVWWWWXXWXXZ[YQZa`UgsZXA9H^kinppfuU6]]m}nRTVfZhhkAYPcMQYDPJWMEKOA?RKQQWGHX\WVXK>SZ[[__T<[b^dZZSW`ceYZegOVXPSia\\Wh`SWUfj`Xca`efY]bVigcagaWWQTLQV^WYRWNKOV][YTXYb[ZN^eb]MRHPYGWrUYzbLDBERmwntyoaVTRMFOg~|||yyxvwuutroibULFFDBAA=@<=>=;;;:889878776667>=;<;=;;;:;;:875544545543332431000000000/00000nmnnoonmomnnnnononnnmonollnlnmnllmllmmmnmmmmmnmnnnmmnnpnnononnoomopnpnopnppnmnmmonnnmmmnmlnonmnopnoooooopoopqooooopqnooppopoqopopoooqppooooppnnnonpqppoporoqponpnnnopomonopoonnnomnononnonnopooqoppponnnoonpnpooonnnonoopooonpopnnomnporqpooppooomnpoonoooqoopopoonnnmnnnmqnmnmry~}|ywtspnnmmnkkkkkkkijggjiihhiggggjljieg{ýȾ_`b_``_aaaccebdeddehhhho{~}yy|xwwtppnmmmkpssrqnlkhgfebcc`]]]\Z[`a`_`^][ZXXXYXWXWWVVVWVWUWWWX[XXZVXSO`XTpi[YM7CamhqpllqT8[YsgMSXd_dmKIXa[EZKGKUMG=E>>MVEQRSIPXXQQPD@Wa`[XYO:^bZcX\PW^ccY[b`MRYO\mb]X^f[TM`goZVbXdhg^[^Whba\Y^]VV[MIM[\XYRNOPUOWXWSQa^]NUYe_]KQE\MT]gD}eOECDNg{osxraUVRNHPf~~}||{yywtutsokaWLEECCB@A?;<><;;;;777688676778>CHIIIIHHIIGGHHHHHFHHHFHHFEEEEFDDEFFDDBDDEDDBCCCCCCAAAA@A@>?>>>==<<;<=<;;;::96564555444333453100/000000010000nonnnnmmononnnonomonnommnnmmlmmmomomllmlmmmmnmmmnlnmmonpnnnnmonmononnooopoopommnomnnnnomnonmmnpopooooooooqnnpnopooooopooooppoppqopopnpppoopppooorpqpqrprppqpqopnnppoonooompnomonmmnnmonnnooopoqoopopnnnnpmnnnomoonnoononopppnononmpnnqqsrrpopnonooooomqnpoqnnoonnnonnnonnnnonlmry||zywssrponmmmkkjklkjiijjkiiiiihhhggegggtĽÿ{a`c_`cbbb`cccccefffiggio}~yz|zwwtqonmmmlpttuqnmjjhfdedb`][XWWY^b`^^]\Z[ZXYXXXWWWVVWWWWWWXXXYXYXVYWNaT]hUZWR4:gogonlijT:S]p~YTK`cddcEX[fIRO?RCKM@HGD=ZQGNQMIU^UWZPCH^b_][SHD`]\T\bQOYbbS\[\NSZJ\lf^O`gZQPgfoX[YZhjb^^aVbad^[Y[VRY[ONN[UYQIPOQOQ^YNN[h`YY]Y]YTMGK\RV\GniTGBBLdssysdYURLGMd~~}|{{{ywvttroi`VKFEDCAAAA<:><=;;;779;87867777?DJJJIIIIIIHGHIIGGHGEIHHGFEFEDDDDDEFFEDCECCDDDCDBCCABAB@????>>>><>=<<;;;<;<;8667565544343354310/000000/001012npooonononoonpnpnnooopnpoopoonommnnmononommomnnnnnnopoopopponopopoppppoopopoppqopmonnonooooppppnpopoppppqppppoqrprroqoqqprprpqpoqqqqrpqpporqqprqprpspqqpqrprqpqpqooppopppnpppopppoopppoooooqpqqprrqoopopoponqpponooonppqprqpqppooqnpppqqrrrqqqqppopqqppqqpopqpppopooonpooooonnot{~|zyyurpppnklmlllmlkiijiihigiijjhiiihhhfpǿs``a`ccbbdcefeeefdfhihjgq||}|{wturqnmnontsurrqpkikffee`_]YXXVY^ba_^^]ZZYYXXWWXWWWVWXWWWWYYWWXYVX[SQ\TeZQZMQ1:ghinmhmiLBPUo~O]Hl]fgTOVeZHSAKOKE@>XB@F]JFJIFN`[\_TTBW_]]XUGBGRU\Q\`TJS[[TZabOSYNahcZMfeXJXjlmT^Ybdeedaa\ga_`_\WWTWZULSSY\WKQPDFKH]WLWe][ad^`^]MOD\Y\MP\lVIFDJa}vsytfZVTMGGd~~}|||zywvtrqi`TLFFDBBB@A<<<>=;<=:98;:87868::?EKJIIIHIJJJHIHHIHHGGHGIGEFGGHEGEFDEEFDFDDEDCEDCCCCBBBAAA@@???==>>=<<;<;=<=<8666676545435455310/0000000001122oqnpoonpnpopponoqoopnooponpooooooomnonpnnnomnoononpqnoppppppqopppqpoooqpppqppoppoooonooononoonpqpqpqorppppqpppopqqqprpppqrqqppppppqpqqppqpqrrqsrtrrqqqrrqqrrrrpoopppnpqpopopnpopopoopoponoqqsqqrppppoopoqoopopoonopoqpppqqppqnpoonoporsqssrqqqppopqpqpoqqqqqrppqnpqoqopopoppoons{}|zxsrroommnlmlklmlikkjijhhijighijfkhgfmm]a`a`bcdeeceeefgfeghgghp|~}~|ywrtsqnmmmosrrsrtqmomhhfe`_]XVWWW^b`_^^Y[YYXVXWWXWXWWWVUVWWXXVWYXU[[NO_\`XYVET;8aeepfildOIJRpwO[PpcgkIYY\EIHBRHOD5HKE;JMCCLGB[_a`[POFa^^\VXFGHNWWWceYKQYYQXckROVNgaeYOlaOJeildVW_hdaca^Y\ec]`_a]SRVNYGRRU[\OPUUDDIHYOP[_Ufcfbe]XLIK`[SLS~r\LFDH]ywtxxk[YWPGG`~~~{ywxusqi_UJFEDCDAB@@@?>=><<997::9687899>EJIIIIHJIIJJIIFIHGGIHGFFGFEIIFFGFDGEDDGEECDCEDDDDCDCBAABAAA??>===<;<===<<;9746766565654446420100101001001021poopoppppnoooooponoopoqppoppoqoonpnponnnmpnooononopnppoppopopppqpppooopoppppppprppqpppmpoppqoqrpqqppqqqoqrqqqrppqpoppporqorpqpqrqpqsqqprpqpqqrrrsrssssprqqqqqpqppqpoqppqpppnrprpoqqppqpopqrrrrsppqpqqqoooqqoopoqpqopopppqrqqpppproporqsrsrqqspqpqqooqqrqqprprqqqprqopopppoopqoot{~}{|yxsrqpmlllmnllllkljjkliijiiijhjhjiifj{i^`_accabbccdfefghfhhjikq~{|{wwsrroopqnonrrsrspmqkggcc_^ZXUTUX_`__^\[Z[ZWXYYYXWXWWWWYWXXXWWXXXNV[FIU`bTVIM_F/[bjpihfjNBAWooVV\h^i\O[\CCICMLJK?7ZGF?LECBQEGdcc]VNGT^`a[YTGJMPaXdeeYEV[RO\ceONPLideQPpbGTlko][Vfffc^\[W[b^Z\^__TQ[XWGQVWXYKXZ`ZHEEKQR[ZOgdfec^^QK@ca]MN^t`NFDHZvysywk\VVOII^}~}~z{{wvqj`SJHEFDBBA@@>??>?<<998;:;769867?HIIHIKIJJJKIKIHHHGIHIIEEGFFHFFGFFGFFFEFDDDEDEEDDCCBBBCC@A@@@@>?>>====<<<=<:666666665624454321010000010002222noqooppoopnooqoppqooooopoppoooooooppoonnoononnnonqpooopopppppppqppoppppppqpppqppopqppopooopqnprqpqqqqrprpqqqpprrqqqqqqqqqpqpqrqoqrpqrqqqsprqrrrrssqtqrrqrpsrpqppqppopoqpppppqppqpqpqpqqqrqpqqrspopopopoqooqpppopopoqqorrrqpoqqopooqrqpsssrtqqqqqrqqqrqqqqpprrqrpooqopooppqopqpps|~|zzyusrppmmklllmnklkjkkjmkjjkiijhhiihhekvd]^``bdcdffcehffffegghhiq}{|ywvsstqpqutrsqqsqrnppiffca]^XUVVVX_a`_^\[[ZZXXZWXYWXXXWWWWWWVXYWVZJRTADOZaNM?[aN(PajqkedbA?GWjiYTd`gdNSZD>DGEQEKL6OSG>>JI;O[>Pke[QGJDZ]bYRSL@HOb\WddfZDNQMMaibNMKJjcaORn_A_klkSY`dhdg]Y[[^\ZUX]\^RQ\VZNHTTXRJZ\ZdWKOJOIZ`S\cjhl^^\KERi^TQNxcPHEIVq{syxl_WWPKIZ{}{}zvvri`TJHEEDBCA@>>==>>=<:<<;<998897:@GIJIHKIJIIJJJJJHHHHHHHHHGHGGGFFFGHDHGEEFGEFEEDDCBBCCBABAAAAA>@@@?>>=><=<<;7576766665443354310010101010111222rqpppnooooqppoqnponppppqqqppoqppppppopqppoopnooooqpqqppqpqpqpqqpoqppqqpqqpqpspqqqpqoqrpprrpqqqrqrprqprqsrprqpqrrpprqqqorqprrqrqrqrsrrqpsqrqtrssstttsrsrrrrrrropprpppqppqqpqpqqoroqppqqrrrrrrrrqpqqpopprpqppppqqoqqrqpqrrqrqqpqqpqqrppstutssstrrqrqrpqrrqsqrsrrrqrrrqrqrpqqpqpsou}~|{yurropppnlmlmmlklmjillljjmkkjjhhfgiknx{a`babaccffeegehhhhhiiihjr|zyxwxwwxuutuvsqpornonnlhcec_^ZZVUWVY_b_^^[[\Z[YYXWWXWWWWWXWWWWXWYYW]QRQFLM]VWLRZ]R)D_hkj`eWDDEShc_Sc_i]OUH@>>=<<;<8::;9:78::AIKLJIGIJJJIKKKKIIKIHHGGFFGGHGGGGFGGEFGFFFEEEEEDEDBBCBABBAAA@A??>>=>><<<<<;7676876555434443300000111000012210qrqqpppqoqpqoqppprpqrrpqppoqpqqqqqpoqqpqppopqoooorqqqqqpqrqppqqqqqrrqqqoqppqqqqpqqpqrrqqsrqprqqprqrqrrqqrqrsrrqpssrrrtqrrtprqsqrtqqrqsrpstsrtstrsstsssstrtsrqqrqrprsqqqpsqrqqqrrrpsrssrsssssrssqsqqqqrppqrrqsproqqqsstsssrqprprqrrrqsrttsustsqrsrrrqrrrsrrrqrpqrqqrrpqqqrrqrqqpw~~}||ywssrqppopmnnmmlmmlknjjkkkljijkijlhim|»q_`ccdeededfffhgdggghhiiip|{xwx{zwyywuuuupqqpnnlijeefca^ZZVUSSZ_b_^][\ZZZYXYXXWWXXWXWXWWWYXXW[_OLNKQQ]UXF`Z_W-;Zind]dQCLKMi_]SdabSTQ@B=LHMOJM7JUEE:MRDD]P5ZXRTIPPW_WOXPOJ<;<<99;;::99;9:BIKJIIIIJKJJJIIIIJHIIHHIHHFHHGIFFHFFGFHGGFEEFDDCCCDDBBACBB@?B@@A@>?>><=<=<86577766545534442100000010111221111sqrrqqtqsqqqqqsrrqrqqqqsqqrqqqpqqqrqqqqqqqqqqoqppsprrqqrrqsqrrqqprqqqrqrsqsqrsqqqqrqqtqssrtusrstqtqssrtsssrststrrrrsrtrssqstttsrststsrsstrusttttttutututusstrssqrtsqrrssrqqqqrsrrsssrtsssststrprqrrrrrsqsrsssrqsrtsrsrttrsrrsqrqsssststvttsuttustrrssstssssssrrqsrssrssrsrrsrssv~~~|z|wvttrqqnpqnmolmnnllllkjjklliklhhjkkm|ľlaacbedfecfciffhffgfijhilt{{zzw{}{{xwwuvsqomlkkgijghefb^\[WWVUY`a``[^]\[YXXXZXYWWWWWWWWWWYXXZZ_QKHGWSW`KJcY_X15Sim`__PDNJ>c[[Pdb_SYBH;CDFQGVH6VGC?DPFXM[D7\PFNIRGPTLQNHCG8HUEZZ^^XRBCKOacbWMHASffXK[eLYfjiUYlcf]i`[U\`a\YU`^WOQ]XRWPTVR[PZ\SRTYQNRUZNMSVWVfhinkaKJTg^PHVgn^QJFNfwx}td[[XPKSs~zyul^TJFIFDCDDA@@?>>=;<<8;889;89:7;BIKKJIJIJJLIKKJHJJIIHIHIHHHIIHGHIHHHGGGFFFFEEFDDCDDDDCCCCBBBABAAA??=>=>><<98778876655533532100100101122201222rusrrrqrrrsqpqqqqqqrqqrrpqpqrrrqqqrrrrqqqpqpqsqsrrqqrsrrqqsrrrrqrqrsssqtqrsrqrrqssstrsqsstsstssrssttssstrrtqrrttsstrrsssrtsssrsrursstrrstsruttustuvvtsttttsrsrrssrrrsrqqrrsrrrsrqtrtsqssttsrrrsrsrrssqsqrrrrrrrqsrssttrsrsrrqrrssrtsssuutuuuutussstrtrststrrrrrrssrrsrssqsqsrrqw~~|zywurtrqqnnnnnnmnmnlllllkllklklkjjijjo~ÿe_dbadefdffdffgfegfcgikjltzzz{zzyzywwwvttpkhihhfgjgffa`^ZXWVTSZ`c`^][[[[ZYYXYWWWWWWWWWWWWXWYW\^RLF@\RXaAYY^\Z:6QhjZa\PHOSCZZ]Lc_]WL<=@HWCD@QWITHX@FWARTIPCUIO\MACO7HOFXZQTVTA@JVabd\MH?RffTNd`FdfnhLbjbf^fdYRbd^]\UX^VNXRQO[MN\RQS\[YPQYYNPHSOKJUXQ`ggknfXEObfRMWZrraTKHLb|xxuhY[[RLRo~|ytn_TKHIFDEEEB?@><=;;::9998799:99>><==;85667875655454532110001011112212211trrrsrrrrrrqqqsqrppprsqqqqqqpqqqqrprrqqqrqpqrsqrrsqqrrtrrrrrqqrqrrqrrpqrqqsqqqrqqrqprrtutttsutrsusrrrsssssrssqstqsrstrtrtssrtsrsrqtrsrsttuttustttutqttturstsrssqssqsrrqsrrsqsprrstttstssssrrrsrqrqrrrssrrsqsqrrrsrrssrtppsprrrusssssttuuvtutttutrtrttrsssstsrrqsssrssqrrsrsssrrv}{zzxttssqnnnoomnmommnlmlmmlmmnllmlkkjkn}ƺwcdddaccdehfgijigghdbekhjmv~{yxyuxxxxywuqqokgdeggfgfffdb^ZYXSSTUY`c`_[]\[\ZXXXWWXWWXXWWWWWUYZYUZ]TLFE^WW\E\V_UWF1Lak]^^PCL]JZU_Qd\]W?>9B;MRJPH8TODGSXRQAIZ@TERYJKELRDNLL@QU5KPEYRSSWXCCK`gcb]PE=VgdQNeWGihjcKeefe^baZXgk__^XSYTPZUPL^QRXRNT\\XUJPXOVSLJNNJTSXfhejjbNGZhWMM[eueXNIL_yzxzi[\[SMQk~~}{vk_ULJGJHFEDCDB====<<<::88868:;:=EJKLJJJJJJIIIIJHHIIIJJIIHIHHIHJHGIJIIHHGFEEGFEEEEDEDCCDAADDBACBAA????=<><:56677766465435532000001110211212121ssttssrtrsrrrqrssrrsprsrrrrqrqrrqrqrqqrrrrqrpssttttttqrtqrsprrqqrrrrsqqsrtrprrqtrsrrrttrtuusstutrsttrsrqtssrrtrssstqsstsrsttsrtrtssttvttustttuuutsuutsvtttrtrrsrrrspqrqrrtsstsssstssttsstssssrrsssrrrsrsrqsrtsrtsssursrssssqstutsrussuuvvuutuuttsttssttrtqrrutqrqustssrrssstsstv}}}|ywvsrrrpppppmnoolmmmlmnmmnllkljllkkin{ſʽżmacdececfehegiihgfdecegjkkt~zxyvvxwuxttrmhleccdedcdcced_ZXYXVTVTZab_]]\\[[ZYYXXXWXWYXWVWWVUXXUW\[RHAH]ZWNFVZUTQL3E[iaYcOEO]ESQ]XjY\U6<=>CWRFN?=]VBPUWFMHQO>KKSXLPIIELRYFDWF4UBGKSQPWXFBOdhg^ZNA=XjcPPcNPiheUPcef`]c^[_foeZ\`[RVYQTSMMMRSWKY\UU^UNVVMQKJMNDHUQbke`kh^AMa[NFRjqvfZQKJZt|v~|k\]^ULQi}xmaUMKIKIHHCA?>>>==>887676764655455522101001011112111232srrtsrttssssttsrrsrtsrrrqrsrrrrsrssrrsrqrrrsrtstsstrsutstsssrsrtssusrsstsssrsrussrrrtsuuututsttuuuussttttttvusustttstuttuuusruuttutswstutvsuvuuuutvvvttutttstsuusutststqqsrsstttstuutsttstsrsssssrtrsssrttstsstsstutsssrsrrstrrsstttsuuvvuuututtstrttttttssqssrtrssttststtsttttx~~||ywvsstrrooonoqomnnolmknnoolonmmlnmkjp|Ʒ˾ɺĹeaabdedefefeffihigjgfbghkkt|}yvwtuxvttrrojgg``aa_bbbabb_\[YXWUUTUZbc`]]]]\\ZXYYXWXWWWWXWWVTTXUWX[ZSH@FZPTHHVSXNRQ6KYl_[hLIQeNJTZ[bYYN0BF@HT[AK=N^ZD\QG=UJKRGNWQQEJJHJMZO>PTD9JFIHROQ^WK>Tjfb_[P;=ah]JPdEZfiaOX_gi`\][[fcif^X[\RUYPOQSLG]PRK[\_OR^NWVMXNJIKKBPSVfh`fjbHH[_SJJkmzj\RMKVp~x~o`]`XNPg{mbWNMLJKIHE???@@><<<<::78987;9;=DJMKKLLJJLJIIHMJJKJJKIHIHIHGHHGGIIGGFIGEFEFEEEFEFFEEDDDCBCCABAAA@@>??>==<767776656553345320101000211112111202tsstsrrsssussrrtstssstrsrrrrrssqsqsrrrsqrqsrrtrttttttttstsvtsuuqtrtsqqrrsqurtssstrstruttuvttutvtuuustvrutstststsssututtsssstststtsutsuvvutvuuuuuvuvvtutusttttstttusttrtttsrsstrstttsstutstsrssrrttrqsstrstpstsststrtttrtssrrssurtttrtuuuutvvvuvustsussustsuttsssrtrsqststrrtrtrw~~||{wvtstrpnqqponpmnoooolnnnonnlnnmmkmmo}˿̼ubacbefeffhffhfhgigijg`hjkks~}zwusttwropnojheb^^]`_]_```][YXVXWUTUTZbc_`]]\\[ZXXXXXWWXWWWWWXVVWSWX[XLKBFVY[FKQSXOWX7GRmY_iNPUhPJX[YaZW@:AXBHR\EU>\]@K^K>FUJLXI]VRUCOG?HTRYgd_`^O=;eaQHV`@`ff[MZ`hb[\]Z^hab`ZRZYU[UPRRQOI\XDKXWaYISVQ[P\VJMIMGGPR[igblfSBYbZRJYhu|l`UNLTmxrb]`XPNaypbYQRMMLJGB??@@??=?<:89776879::>EJKIKKJIIIIJIJIKIIIJIJIIIHIHHIHHGIHFHGHHGFGEGFFGFFDDDDCCCCCCBBAAA@A@>>==;876677655654455210111012110210121121srtttrtssssuttttttqtustsrtsrqrrrrqsrrrtqrrtsutsttutsutstttrtrsssttssrtstrustrttrqtttuusvvsututuuvutuutuvtttttsuttssrtttusstttuutrvuuvutuvtuttuuutuvuvusvtstttttruttuttrttttststuutttutsststrrsqtrssttsrrssssssutttusrstsssrtsstursttuuvwwvuuvstvuutttutttttuttusstrsustttstssstw}~}|zwutsrspqpqooqpnpnmqonomnlmmlmjlknmkqžĸfcddbdefdeehfgfkgjjkjgegghhq|zvssrsvrmljkifdb^a[Z[^]\^^^ZX[XVWVSTSTZaa_^^]][[ZYXYXXYYXWXWXXWWUWSXV\XJH>KOV[@HLVPUX[>DQe[edVTTlRK\XXaXT8FBP4AVOROF^L>WU=OTD>PZI@dedSS]bh][[]U`a_]]]UVY[XTOMQPQMVPJNT\S]VHXSVV\VLOMIKFJO[clghp`HRb`SKSYppcYRLQivvd]bZOO`|pb^XSOMLKFDBAA>>>=?::<:;79:;88;?HMLJKKKKJJKJHKJKIILKJIKJIIIIJIJIGIHHHGHHGGFFGGFFFEFDDDECDBBCABA@A@>>?>==:688677655654355221101131120211202212svuussssstsstrtsttttstrtsvssurrtrtqtrsqrsrsusssuvtttuutvrtssttssvsuttssrtruststutsuutuvttuuuuuutuvuuuuutuvttttsuututtussuutttttsuutwtuvvuuvvwuwutvttttvtusttttvtsttttsuvstsutsuututsvtvtttstssrtsrtrststsruttsuvttrssuqsrrssttsuuustuuvwuvttuvvuuvusuruttssrsststsuusutssusssttx~|}zxvtrsrrsqqqpropommpponopmnmmnlnmnnmqѷʫĽxcbcdcddddefhghggghkkjgfeedgpxxsrqrqspoiefgb`_][\ZZZ[\\ZZYWXVVTTUSRV[aa`_^]\\ZXYYXWWWWWWWWVWWWSPSYW]YKK8ONT\:HJNR_VWACUdbgZ[WViTG^WWaXT@LFC=IZH[DEK9CZF@?STHU?JXNFFEC5H^K?:VXF<=GDHD`eYYYD9_eb]WUL9=lROMZOFei_MZZbiY\]YR\`^[X]\`U\ZSSKKKZK[MDST^VNRQGWRS`dQNMKGNDMS^egcnjTK_dWJMVcre]SOPdxxg^c\TO]}|oc^YTMMLJFBBBB?>==<:;79;87899:<>HKLLMKKKKJKIHJIIIIKJJIKJJIIKJJJIJJJIHGHFFGFEGGGEDFFDEDFDEDCCCBAAAA???>>=9678677566554553211101212111012111123ttsuuvuussstsststvssutvvussrtutsstttsstusuvuuuuusssttutuvsvuuuuvssuuvtutvuursstvtuuwuuuvuuvvvuuutwuuxuvuvtvuuuuttutuuutututwuvtvwvuvuwvuwwuvuvwwvvvwvuusuuuvutututvwvtvswttuutvvtuuutuussvtsttttsuurststttttttsttttttsttsttttuutuuuuvvvxwwwvvuvttuttusutvsvvtuttuusuttuuuuuuuutw~~}|ywutstrrrrsqnpnpnrnpqqpqnpponlnoonkr~Ĭþicacdcdecffhgjhiiiiijlkkedcdmwvrpqoqrpmihgda`_\]ZW\Z][[XYXVWVVUTSRSV[bd_`]^^\[ZYXXWWWXXWWXWWWWWPSY\YUDK9VRS`?GGKT\TWB?NaiaSa[RlUD^VYa[PHGLEMQWDcBBK;QWAGN`MMF@KPRWH?<7SGG4H_S>@?=CVLeaTYSC>]f]`WUF4CgISKZJOfm\L[[^dSX]QSY^[XWYQ^Xc\RJMHKUOTSGYTVQNMQNJTHWbZGKPHHKBKV_hekq^KVi[PF^Lvi_VQPa~y}}kac`VO]{}naZXWSPMJDECBC@=<<<9:;:998898:>@JLMLKJLLJLLKJKKKKKKKIKJIKKIJIIIIHJJIHIHHHHGFGFGFGFDDEEDDDCCCCBCAA@@@@??<8877787666665574211001232322223333233wuwsstrtttuuwvtuutusttrvsutuuttvutssurtrttuvusuruuvuuvtvttusttttutvrwuwuttttttsuutuuuvuvvtuvvuuuwvvvtwvtuvtvvtuttvutttuuttvutuutuuvtutvtwuuuvvuuvuuwuuuuvtsutuuuuttttvtuutvtutusvuuuuuststtsutstustttsttsuttutuutttttsssssuuuvtvsuuvvvxwwwvuuvvvwuuuuutsttttututttuuuttutttuuutx~||xvttqrssqqqrqqopoqpnnqpnopopnlonnnjrԸſsccddcedfefffkihfffhjjijhfdccltupnolonplhjea`^_ZZ[WWW[YYWWVWVUUVVTRST[ab__^]\\[ZXXZYXWXXXXWWVWWWUPY\ZXIK=WTUaGLHQYWQPB?PXh[SaUMmWE[Z^ZYKEFQ>MWRNY:JDA_JRFa`LKAGKZZR?62SQEC:Z\B@E4>JVU\SQ[WHFY\X]TYE5F\HOK`ITcoZQX[^^RV]NZRSXXWUMVXeg^NHDFNSTKLZR]NQKLQJQLO]\FTJKHJHCK]ccjqeOVj`SH^Oiwl`YQQawz}o`daVR[w{o^WUVUPLIDCAB?>=<<;9;;;9899;98>;8888877666565653222112222322332232322usstuwuvssusttusrttttuvuuvsssutustssttuuuutttuuttuvuvvuustutuuvuvutvuutuurtuuuttvuuuuuvtwvuuuuuuuwuvuvuvuuvutuuwutvtuurvtutuvvuwvuuvvvuuvwuwwwuvwuvsuttututuvttuuuutuutvtxuvuvuttuttvrutssstttttrusststtrttsuuvttsrtssttsvttstutvvvuvwvxyuvwwvvvuvuuututuutuvutuuutttuuutuutuutx~}~||wtutssqsqrqqopoqqpooqqppqqoopnnomnmr~|˻ɿügbadacdeffhigfhgffhiikhjjgc\^iqrqlmmmmmjghhb`]\\[\[VXVWVVVUTUTTTVSTSSZcb``\[][ZYXXXXWWWXXYWWWXXWXNX[`TTNATTK]HLBO[VSOJ;SWaS[`TOtZKW^aTZHJMP@OWNRJ:F9HLOLJgSOLNNQXUQ>.A]GO8E[W5QF2OK_ZPNXaWGHOX\bRY@2EXJNH_BXaiVVV\`]SWZO^WST]XQLV[W\aUJEGMONIUYNYTNQMJOKMKaZF[VEJBIGFV^_epoVSehTORbVync[UR]t{}rcfe[QXt|k\XVXUOMGDAA@?=>>;;;;;:8:;;887:8897886666666644021103322333233322233uwuuwuuvwvvuvutuwwuuuuuurvuutwvvtuvuvvwuuuwuvvuuwtuuuwuuuuwtwttvtvuuwuuvuuwuuuwutuwvvuwwuuwuwvwuvwvuvvvwvvwvwxwwuwuuuutvuvuutvvvwvxxwvwwvwwwxwvwwvvvvvuvvuvvwuvuvuuvuvutvvvwwvuvtvuuuuvvsusuvttuusuuusutvvutvuuttuutttutuvvvvvuuvvvvvwwxvyvwvvvwvvvvuuvuuutvuuxuuuwtvvuvtvvuuutx|{zxvsstssqrrprpoqpqpopqrpqqqnoqponoorjdraaeeddffefihjjihihjhhijlifa[_grsmkllmmmkjjgb_]\\[YYWXXWWUUSWTUTVUSWUV\ba``]]]]ZZYXXWWWWXWXXWWWWWWUU\\QSLDKXQ^KG>TW[QQS0HR]Ob[RPtZSU`aRZBMINBQ^GS>@D=DJOJW_GLIQNR\ZR34THMM2O]DB]C@^Ie\JV`_V?AH\_bUP<3HWJRH_AZaaMTW]\]TXTVb]KUT\RKW[]NUZQKHHQHQ]WPLZPNIKNMTGW_IZWTKJBJDJY[]nr_R`mYTJaP|qf_XS\n}{ugfh^WZq{k`Y\\XOJFDD@@>?==;;=;;;:::;;:8;BHKMLLKKNKKJLLMJJLJJJLJKKIKIKIIJIJJKIIJIIHHIGFFIGGGFFEFEDDEDDCBBA@AA@?@>:7887876656646652212222232332222223223uvwwuvwwwswvwuxutvuvvuvuxvvtuwtuvuvuvvvvwwvwutvvvvuxvwvvvuuwvuswvvvvxvuvuvvvvvwuwvvvwvvwwvvwwvuwvvxwwvvvvvwuwwwwwvvvvvwuvvvuwwvwvwvvxxwwwwwxwwvwvwwvuuvuvvvvuwutwuvvvvuwwwwwwwwvwuvuuuuvvvttuuttttuuuuvtuutwvuuttttvtvsuwttvvvvvuuxvwxxywzwwwvvwvvvuvuvtwvuvuxvutxwvvvvuwwvvvvwy~}|yvvvutusrstqsqqsrrrpqpqqrsqoppoomooqnF?@G[IdPMGNERUVbS@(EIBYAA><<;=<::<::;::9=CLLMMNNKKMLKMLNLKKJKJJKKJKKJJIIJJKJIIJIIHIJHJHIFHIGEFFGHEDCDDCBBBABA@?><89889867676767642111122322223233222333wwwwvxwwvvwwvvwwuvwvtvuvuwuuvvvvwvvwwuvwwwxwwvvxvwvvvwwvvwvwvvwwwvvwwuuvwvvxvvvxwvvwwvvwwwvxvvwwwvxwvwwxwxxvvxvxwxxwvwxwuwuwuwvwxxywwxwwwxwwxwvwxuvvvwvwvwuwvwwwwxvvuwtuwwvwwxwxvuvvwttttuuvuuvuvsuvvuvuuuuvvvvutwvuuuwvvvvvwwuvwuuwvvxxxxxvxxvvvvwvvuxvvvvuvvvwwvwvvvwvvvwvvwvz~||ywwuttttuttqrrtsrsqrrrqoqspoqqooopnsy@Fidcafedccegffhggkijiecacggea][]frtqnnpmkjilmkgd`__]\[[XVUWUUUUUVTTVSUSV\ba^^]]\[ZZWYXXZYYYWWWXWWWYZVRLUFWY?GTA^QFIYZSMJN:FRf_VS^Gn_ZR`^X]?KQFBQWBMDA5CUM`YFCHJMV\U`W90K:BL5E[?>QC6UM[[RMT^\QA=RclYMC69EWQSLOA^aSKX_WW[RTH[]WENUTWWSQRXTPOIHEAQO]WMTCJSIMPQI>=;;9::<:9:<<>DLNMLLLKKLLLMKLLJJLLLKJKKKKLKKJKKIKIJIHIIIHIIIIIGGHGGFFFFDEEDEDCABAA@??<89799886667667632112133232333223233334vvxwxxwvwxwvwwvxwutuxuvuuswvtvwuwuwwvywwvwxwywwwvuvvwvvvvvwvwtvvvxxuxvwvwvvywwxwyyxwvvxvvvvwwvwwwxxxxxvwwwvyxxxwxwywwvwvvvwvwxxyvxxwxxxzwxwxvxvwwwvvvuvvvxuvwuvvvvvwwwwvxwxwwwxwvwvvuuuuvuuutttuvuvuvuuvutwwuttvutvutvutvvwvwwwwwvxwwwzxyywxxvxvwwwvvuvuxuvwwvvwxwwuvwvvvwwxwwuy~}|zxvutststrurtrsrrrqsssrrpqrrpqqoopnsP3xþpa`cceeccddfghjliiifdcfedfhc_Y\\hrtsnolkijlimkffcb^\\\[YVTUVUUUUUUUVRUTV]ca__]\][[[YXYYXXWXWWWWWVZZTVXQKM[SJ>\F\WFOZWLPDI?>WccON^Jia]Qa_[\BFNE@RT@FD:9ERNdE@EGORZeU^Q*?J8D?2VU7HO>CIK__NHZhVM>C_bfPO<<5@TQVKD?_aMPU\TZVPJP[[UKNNNTYONEQQNJHGHBKKXVZIK:LKALXJ:COF^X\_LJ?CCIPSP_pXPXsWTF\\{vng_YYgymilh^YjxneaYTNHEDEB@ABA=<><:;::;<;;:;<@FLLMMLMLLLLLLLLJKJMKLNKKKKJKJKIKKIJJIIJIIIIJHIHIHHGGGEGFFEEFDECCCBAAA@<998799988765466532223233243333223333323xwxvxwwwvvwwwxxwxwyxxwvvvuwvvvvvvwwvwxxxyxwxwwxxxxwwvwxvvwuxuxwxwvwxtxwxwwvwuyxxyxyxywyxwxxwxvvwwxyvxxwwxxwwwxxwxxxxwxxxxxxwxxxuxvxyvxwvxxxxxxxxxwwwvwwwwvwwwwxwwvwvwvvwwwxxxxxxwuwwwwuuvvvvwvuuvvvvuvvwvvvvuuuvuvvvvvvvwvwwwwvwwwuwxxzxzxzxvwvxvvwwwwvxwxwvuxxywwwwwvxvwyvxvxwz~zxwwwttstsutstssrqqprrrprruqqrrqpppoq~c3Vwedecaccfgeegfjhghfdeecfdfedb`[\\grtuppnlklkijjkgfa`][\[ZZVWWUWVTUVSRTUSW^bdb`^]\\\ZZZWWWVXXWVWWXVYRUZZZNN\SL9TH\\ERYRGTJDK9[^bGLfOe_]T_a_YGIQJ?SPALA:=IPeL;FGFOa[^X]>)ID?F@=Z<KGARcTJM_bSNHP`Y`SP7C7BNMPJ>?_RFSZRN^TKITUYRMMSHWYKIHKOHKGEFJBJWV]MLCEYJ?WQ8@AHOQRNkaRVk[TITciwphb]Xd||qhllcZh|lbWTRPIDDCB@?>@>?><<<9;;::;=<;=FLMMNMMLLMKKLKKLKLKLLLKNKIILKKJJKIIJKIIIIIIIHIHHHIHHHGGFEFFEDDDCCBBC@?<99:799787777577532222223233333333332333yyxyywwxxwyxvxxwwzxwywvxwvxwxwwwwwyxxxwwxxxxyxywzwxyywwxvwyxwvvwwwxxwvxvxwxxyyzyzxyyyxxywwwyxxxwywxyxyxwwwxwxxwxyxvwyywxxwyyzxxyyxywxxzxwxzyyxxwxvwwwwwwxwwwwwvwwwwwwwxxyxxxwxxwwyvuwwxwuvvwvuvwuwtwxwxvwwwxvwvvvwwvvvuvwyvwwwwvwxxxyyy|zyywwwxwwwwwwwxwvwvwxxuxxvxwxwvywwxxwvw{{zywytuustwvttuusrrsttppqsrrrrqqqpppus8?c`bbcdbeeffggfghgfd`baeeaedcd^^[]htuurqnkkiijjlnjgca_[\][[YWXVVVWTVUVUTTW_cda_^^[]Z[YZWWXWWWWWVWWWZQXX]`KPXQJ@LLZ_HS]PDUHFM7WYbJQhRaaXZ[abWGNRHCQILMB>?ZY\?GNFKZjScYX.3RA>S<@F:AALJIV`WXZA4ABKQRI`iK^e_VKMbXxogb^Ybx{qhmng_hxi\RRPLGEDAAA@?@??=><<<;;;:<;:==GLMMLLLLLLMMKLMMLLLMMKIMKIKLLLLJJKJJJJJJIIIIIIHIHIHGGHHFFEEFDCDCCAAA@?<:::899877777676422332333343333333233333wyyxxxyxyywzyzyyxxxyxyxxxxwyxxxwxxwxxwyxzyyzzyyyzzxyyyywxyxxwyxxywwxyyxyxzyy{zyzzzyzzx{xyzyyyxyyxyxyxxxzxyyyywxzyyxyyxzyzzzzzzyyyyyyyxzyyyxzywxwxxyxxwyyxxxwwxwxwvyxwxvxxywy{yyuxvwxwwxwxwxwvyvwxwwxwxwwxywwvwvwwwwuwwwwxxxwxxwwzxxwyx{yzzzyyywywyyzxyxxwywwvxyxvxzvxwxyyxyywxx{}}zzyvwvuwsvtustuvsstrrrtrrspttsrrqplq|{vojE4s¿kecccedcdffgefhhehhe``^fbaeeceb_[^juxvssqnkhggkmlkjgc`_]]]]\XYYXWXWWVTUUTW_eb`_]^]][YYXWXWWWWWWXXWYTUYX]XDLXOCKGMV_LP]QIVALG;SP`UUfW`i]^[fcXJOJEJZKXE@=K^bOHNGJSh[T[R@(BH8JV4<:IE6QV?C^ZKScJP?IPVYP^IL:[@?HKWR@F]DLUTEXdKO^RYQIDHONQVO@MMJRGMJJDEONZgKYU>AZU?GECKKJK``W^V>7:HOPNPiO[hdWUK^R{zqje`Z`t~uklpi`g}qfXPOMIIFCCA???>B?>?==>?=;9<><<@JMMMMMLNNLMMLNMLLKLLLLMKJJKKMMJKLJIKLJKJJKIJJIIIIHHIGHHHFHDFDDDBBCBC@?::::999886876777422332233333332334333333zxxxyyxxyyyyyyyxxywxyywyyxyxyxxwwwyxzxyzxyyxyxzxyxxxzxyyyxxyxyxxwxxywwwyxyxzyyyzxzyzyyzzyyyxxyxyxwzxyxxvxxxxxyyxzyywwyxxzxzyxy{yzyyxyyyyyzyxxywxxwwwxywxxwxwwxwxwxwyxyxyyzyyzxzyxywxxxxxwwwwwwwwwwuwvwyvxwxwwuxvuvvxwxvxwxvxxxwxxyyyyyz{{yxzwyyywxxxwxxyyxxxwxwxxyxxxyxxyxwxyxyz{|yyxvvuuvvuuusrsttsusstutrrssrprqsbTafhcb_]_X5[¾sfceddeffcdfhefghggeca`abcdfddea_]^kwyutronljjgillmkggb```][ZZ[ZYYXWXYWWVUW_dba_`^]\[YZXXWXWWYXWWVSXTUSX[VLPUMCMBJQ]NK_PMOEPCFJNW]_dX[i^b[edZNJEOKRJY=A?R\]IUMLZaV\XRM7.EF=SH;=ELB9[TBIbVFS]BJEUPUUTWLR@b:>LJ]U=L\AL[TDYZDT]JZMEGFTMSQK@GMGJJCGD?CINU[^MZE7G^E=BBCLKFO[[O[S87?FRQGc^TihUUL\_a~ske`[]qvjksj`g|wl]PNMKHFDCCAA>?=?>>@??<<:<;9=;=EJMLLMMNMNNKNNMMMKLMLLJKKLLJLKJJJLLLJJKJJJJIJIKJIHHHIHGGGHFEEDECDCCABA>;99;;:;897767775423332333343433333334334{zywzxyyyxxxxyxywyw{wxzwyxxyy{yywxxw{zy{xxxyzzxzxxzyxyxyzyyywyxvwxvxxxwxzy{y{zzyyzyxyzyyx{zxywyyxyxxwwwyxwywyyyyxyxyyzy{zzzy{yyyyzxzyzzyxxxywwwwxxxwxwxxxxwwxxywxwxxxwyxyywyyxxyxvyxxxxwxwyxwxvvuwwwwvxvwvvvwuwuxvwwwxwwyvxxwxwwxyxxxyz{zzzxyxyyyzxxwzywyxyywxyywxyywxwyxxyxyxvy~{{zywwxwuwvvvtuttttuttrtustqrsqrrqpNAYgccdceemG`|iededddebdgfefefhggbaccabdefbdec__anyzvsqooljihhkkmlkhcaa_^]]][\[ZXYZXXXZYYaeccc`_^]\\ZZ[ZXWWYWVXSWZNPX]OZUMTGBP@HRZSJbUWRJQBLGLZaheaVgY]YgdZMIRV@NJQAFA\_TBUIZ^cU_QOG,6LBCSC<OW8L\LBQLD]^JTUGIDSUSMI@FGGHLDDB>EGIUPZDRT<>XOJ@F=@LR@MYVS`M4=>NSLYfTcmYWLLbYslge__nxkkrmcd|ztgWOKJIGEDCC@@>?=><;<;>AJLLMNNMONOMLNMOMLKLLLLLLLLLLLKJLKKKJJIJJJJLJJKIHIIHHHHHGHFEDEDDBBBCA@<:;;::8:887676853323222333333334433434332zzzzyzzxzy{zzyxyyyzxzyy{yyyywxzyz{zyyyyzyyyxyzzzzyyzzzyyy{yzzzwzyyyxxxzzzxyzz{{zzzz{zyzzzyyy{yxyxxyyyzyzyzyzzyywxy{{yyyyzzz{z|z{{{{yxxxzzyzxyzvzxwyywxyxxywxwwxyzyxxzwzzzzzyyyxyyyxyywxxzxxxxywwxwxwwxwyxxwxwwxxwwvxxywyxyyyxzyywyyzzzz|{zzzyzyzyxyzxyywxwxyyxxxxwyxyzzxywwyzyx{}|{xxwxxuuvuwttvttuuusrttusrrtprqreA>Wmkgdccerimulfedcdeecfeefbfcefee_dabcdgebccb_deoyyvtrponkkigjkmlkjeaba`^]][\ZZZZZZYZYX\bfedc`b`^]^[[\YZXYXXXUV[RMU[NUWTKOBBF=HXRWK^\[RNW;OMEXde^bRcY\XcbZLHWRCPKJCDLd]GLXEhY_[UMM@+@O8GOQOf[bm]YPFZ[zwniea^n}kksndc}|zwqcSKIHHFECACAA@A<:=@?=<><:<;===>DKLLNONOOOMLLMNMLMLLLKKLJKLKLLLKKJLLLJMKIIJJKJJJJHJKIGHHHFGFDEEDDCBBA@<;;::;::;96998963333334344334443244343323{{z{{zzyzyyxyyyxyzyzyzyyyxyxzyzz{{y{z|yy{yyyzzyyyzyzyyyzyyzyy{yzxxyxyzyyzz{{z{yzz{|yyzzzz{z{yzzyyzyzzyzxyxyyzxzzzyxzyzz|{z{z{{yzz{||yzzzzzyyyxyxyyxxxwyxxwxxyyyywzyyyxyyyyyzyyyzxwyywwxyuywxxxxywwxwxxwxvwxvwxvwwwwywzvzyyxyxxxxxzwyyzz|yyzyxyxyxzzwyyyxyyxywzyyyxxyyyxzxxxxxxxy}{zyxwvwvvvvvvtvttwtuutsttsrtqqrsuW<;CL>C[TQ?F?>TPM?GfWNSUREH\]?GJAUhRIKKA@JMPMG?CQTRKMU6NC>FGFOIMKMQ:?JGDG?8OOH>MQQV\E9:GRTM``ajfZQHP_qxrihdainkspday|zvn`PMIGEEEBBCBA?A>@??@?9<;<;;=<;BRFG9R_QQSUREL:XZ6>TVe[@PG>^[9IICUeWIMI@AQSHRE8CJXSVF_AIBBGHGJLLSBSG8CEFM:?ROH:AJMSZR=:@UQMYg^lgVQKLdg~{qkgfbg|~nlsqf_v}|xtl]PKIHFEABDAB?=>>A=>?><<<;<;;=;=FKNNNOMOOOOLMNMMNLMNLLMMLLLKLLKKLLLKJJJLLKJLJKJJIIIIIHIHGHFFEDDEDCCCA?;;<<;::998798;956333334333544544434543464|{z{z|}zz{zz|yzy{{yzzy{{{z{y{z{y{{{{|{{|z|||{zz{x{zz{z{yzzz{z{{zzz{zzy{{|zz{z{z{{|zz{{|{{{{zz|{|z{||{yzzz{yz{yzzzyy{z|z{|x|zz{z{|||~z}zzzxxx{yzzxyyxyyzzyzzyyzyzzyxyyzyzzzyxyxzwyxxxyxxxyzwyxyyxyxxxxwxwwzwwxxwxxxwyyxxxzyyxzyyyyyyyz{zz{y{xzzz{zyzzxzzzzyzzzyyzz{yx{zyx{yyxyxxz~}|z{xyvxxvutvwuvtvuutvsutqttsqssqX@=>CbqnjkfcRgt~snfcfeceigfgcedcefcbadfbffjhgd_a`dcepyuvssqpnnlmmomjkjkjgfcbb__]]\\]Z[[[]]^_gifecdca`b_`_^]]][\[\^TRUYTU[UQQEG;9=8EJRYRV[YMSWEEXFIP`gfWXb]`QdgPQhVJZJMBC^`NT^M[T\bIFIC@KI5PI=<9I8A=@=?:<;;;?=<>@DLNLMNMPONOONNNNNMMNNMKMMLKMMLLMKLLJLJKLLLKJJLJIJIJJJHIHGHFEEDDEEBCB@<;;<;;;:::8878:844335445444345544443435344z|{zz|zz|{|{{|{|zz{{z{zzyyyz||{}{|{z{z}|{{|y{yz{{{zz{{{{zz{z{{{z|{z{{{|{|{{{{|{z{z{|}z|zz{{z{|}z||{{{|yzzyyxz{zxyz{{{{{}||z|}{}{{||{}|||{zzyyy{zzxzzy{yzyyzyzzwxxyzzxz{{zwyyyzyyyyyyxzyxyyz{yz{yxzxzzwxxyxyzwxxxwxzxwxxyxyxyyy{zyyz{yy|||zyyzzzzzz{yzxzy{{zxzy{yxzyyyxyxyyyzzzy|~|{yywvwwwvuwwvvuvuutsssrtsrrrqtgG?>=@Vrumjn`>Qr}~smfbeffghfdffgfgdhecdfffhjkhgab``aafqzxuutrppnlmnmmlkjkkihddca`_^_^]\]][]\]cgjghfeedab`a``^_][]^aYUWV[SYZYMOE>?>@6EJKMYO\\PRXGGXJ>V^ljYUd]eUahHOfNJWMGFD^SP^ZIaWbRHLN7BGA?QF==EH/D\^RGAAD9DFKOHVN?\H6ABWI??QMK7BGKQUU?9IYTKeimZ]RQP[^kvoihghwvmrui^pzvtk[OJGFGBECC@ABBC@FMNLMMMOOONNLMMLMNLOMLLLLNLLLLLLLLLKKJJLKLLKKLKJJJJJIJIHIHGFGEDEDDDD?;;;<==:::::79:8845433344544554456535545455|{|{z}}{{{{{{|{||z||{y{|{{{|{}|z}{}{|}z|{||~|||yy|{|{z|yz|{{z{|{z||yz}{{{{{{{{|z|{|yz{||z|{z}{{z{{{z{{|{{{z{{{{z||{{{{}{}z~z|||}|{|{||{{y{{{zzzyyzyx{zyzyzyzzyzyzzyyz{yz{zyyzyzxxyyyzyzyzyyxyz{zzzxxyzzxzwyxyxxwxywxyzy{yzyyzz{yyyzzz{{|{{zzz|z{zyyzyyzzzyz{yzyyzzzzxzzzyyyyyyz|}}{zwwxyxwxwuxxwwvvtsttuuqqqturoS@??>=Jqwpqp[:Cky{rmgdcefgcdceegigdidfeihjhkhfgddcba_gqwwurqqpomklkkkjjghhhfcc``]\[\[[YYXXWWZ\_ca``^^][ZZWYXXXXXVZWRWSRWQXSSGVERU`maT^\g^ZdJSaOGVMEII]KR`SF\U^OMTF/MC9DPF97NeNCQMHZRBN=V@9>OXdSIL9J^M@FCPV]TJGB>@IXUKE8?GKTKMHI=FK7?BIKPVR>JT;:<^QD>>;<==<;=?<@@==JQNONONOOOOMLNLMPOLNMMMNLMMLLMLMLMMKLKLLJLLJLJIKLIIJIIJJHHHGEEEEDDDD?<=<;;<;;:9988:9633544444544556465454545555|||{}{|{|{|||{||{}|{|||{{{{z{|{{}||z|{}{{{{z|{}|||{{}z{|zz{{{{z{{}{}{{{}|||{{||z|y{||zzz|{||z~|z|{{y{z{|{{z|zyz{||~|||{{{|}|}z~{|{|}||{{yx{z{zzyzzz|yy{zx|y{yx{xzzxyy{zyzxzyyzxxzyzzzzxzyyzyzyyyx{xyxzyxyyyxxxxvxxxywyyyxyzzzzzzzzyyyz||||{{yzzz{{z{{y{zzzz{{yyy{zzyzzzzzyxyyxz}{yyxwwwxvwxuwwxvxuuursrursrsrsbFB@?==Cm|sstZ98^u}{rlhdbdffbddceejjdggegihhiihihga`\[\_gkkifeeda`][^^\]^^\][[XZVSOPPMMMLLIKLKLKNQNNNMNMLNLMMJKKKLMPKJKKLOKQNMF[C9AH>2LMKG[TTOUPMM?VMGQVNnhUQ`b`O`JQaTDXNILLYO[_MMZT^TWU67SH;HUB:=C5DWUEHBF;OA8?^_JJUIKVKHODP<9DJ^_RKD8NYJ@DHM[XTO>E=;J\RJE28VHRNQIG@KL8EGLIQPRCBSC:9YYB8GMIC=?DJRSN?:IRVRebb_YRNOSXwzpliiir{osvlah|y{|zvpi[NHGFEDDCBAAA@@@=<=>=<;=<=?<<=@JOPOONNOONOMNMMNNONMNNMMLLMLKKLLKLMLKLMMLLLLKKKKKKJJJIJIIIIGFFEEEDDB>><<==<;;;;99::8544445354544545554554445555}~||||}||}}|}}|}}}|}{}{|}|}|}||{~}}~|{|}||}|~~{}|{}{{||{|}|}z|||||}|}}~~}|}~z|{||}}{}|}|||{|z}}|||~z{|}|{|}{z{{}|{{||{}|||||}|}}~{}}|}{{}{|||{zz{{zyyzyz{yyz{yz{zzz{{zzyzz{{{yz{z|yxzz{zzy{|{|{z{zxxzz{z{xyzxyxxzxyz}zzzzyzz{z||zzz{y{|}}||{z|{||{{{|{|{{{{{z{{{y{zzy|yzxzz{xyz}~~{|yyxyxywyxxxwvuttttrrpqqqssmNBAA?<=Cd}zvw]:7Ktzzrjdeddeccbdcdgiiegggghihjiihgd\VWVUVWVWVVUSSRQPPOONPRRNOPPNIJKGCEDEC@BACBCBBCBFCDECCBGJICACFCDJEGGHFMHIJLDS[D:>GH5DMALRWSQRPLKBYLLFLDdo`FhbdNYMPaQJWSOMIQUZ]IUXW[WYG3:OM4KR6;=B6QXJGH>=QE50Ld_DINBMPKII@L;8AKc[SHB8RVHAFJGXSYUAB:5KZREC46UQNPJGECMF9GFMCRRUKEKE:>A@?==>?==>??>;?BLPQPOMOPPPOONOMMONNNOONNLMMMMNLMKLLMLKKLKLLMLKMKKLKLIJJJIIIFFFGEDCDA===>==<;;;:99:98634534544655645565455565454}~||}~}}}}}}|}}|}||}}}}~~}}{|{}|~|}||}{}}}}{|||~{||||{}{}{~|}~}|~~}~~~~~~}~||}|}}|||}||~{}{}{}}}|{|}}}}|{|~|}|}}}}||}}}|~|{}}~~|}|||{{|}{|z{z{{{zz{|zzyz{|z{|{zyzzzzyzzzz|y{z{z{zz{|zz{z{|zxzzzxyyz{{zzyzyzyzxyyzyzzz{{{zzz{yzyz{||}z{yz{yz{y{yzy{zz{{z{{z{{zyzz{xyyyzzxyz}{yyxwwvuwvuwtsqqrsrrrrrqossnm]DAAB@?>@]||z{\:8;b}yuythdccbac^`abbbegghggihfgegehjf`VRQTPQRPPPRSPOQSPSOMPPRRRQRPNKKKMLILKIJJKJLKMLMMNNKDDFEJPOFFFEEHJCGDECOGMLGNUVJBBFT:;QOHIB;BW=17YmMKNEETTHLE>J:7?[cVTJ@;SVGDCIJTM]W@@:3OZOE?36MOKRGF=EP?4@DMJNUMNDFH?=LPL;=IRDH=EEHLSQ:>SYScfme^QNSNOiztpkjkorsuncd|{unfa_afikjcTMHHEDEDCABBBAAA>>>>=>=>@@=<=@FMPPOPOOOQPOPOOONMMONNNMMLMLMMMNMLLLMLLMKMMLLKKJKLKKJJJJJIIIIHFFEEDD>>><==<<;<;;:;::7545444455566566455544555555~}}~|}|~~}~|~}}}}|}}~~~}}~~~~|}|}|~~}~}~}~}}}~}~|||||{|}|}~}}}}}}}}}~~}~}||}|}}}~~}|||}|}|}}}}}||}||~}}}}}}}|}|}}||~}|~|~}}||~{||||{}{{{}|}}{|{z|zz|zzzz{|z{zzzzxwyzzz{{{yzzyzzz{yzz{zz{{{{yzzzyyyyyz{zyyyyxyzzxzxzyzyxyyyyxyxxyy||zyyyxyyyzyzzyyxyzxzxywxxxwwxxxwwxwwvvyy|}~{ywusssrrttrqrpmnnppoonnlllkjcNDCAA@@?@S~}|R::9Huxixzutxysh`^^^^[\][\\]^``_cdggdadaecc`b_WUYccbcdeebcefiihfdddegggfggb`b`abddbaabbbedcceec_WJGMLNSSMMMLFIGDKFFEMHNMDPMMQ@7LMC6NJOQ_SXNVMEPHYEOEBS`mP]lj[NJI]ZZIPSLHM_XWKSZ__OBF:GLSGbQ;A<:?SOCF@=JRA.CncBTMGMR\BV9CE:3Bb[XXK>=USEFEFLPI_Z>994O\KI?/9PKQKI???=;<>?@>=>@?CLPPNOOQOOOOPOOOOOOOMNNMMLLMLMMMKMLLLLLLMLMMMLLKLLKJLLJJKJIHGGFGFEEB><>=@YOAHGDPIL_ZE58/G[MP<18MOgHKA?SJ=<;HLMF[MJIHI@:[IRK:KLPBC=DGMJRK>JVS[cneZWOORR^~wqnlkpvtxqfbt~{vokjnruxy{w|yma[TRKGCAABBB@@A??><=<>@@?A==CKPQRPQQPPQQOOOOOOOONONNNMNMMLLMMLNMMNMNMMLLLNLKKLKKKLKJJIJHHIFFDEDA?>?>>><<<;;;;;<85455545556555655466556776556~~~}~~~}~||}~||~~}~}}}|~|~~|}|~}}}~~|}}~}}~}|}}~}~~}~}~~~~}|}}~}{}}|}~}~}~~}}~}~}}~|~~}|~|||~~~~}||}z|{||||{{|{|~|{{|zz{{z{{}zzzzyxz{y{zzzy|{|{zz}{zz|{zz||zzyz|{zyzyzyzyzy{z{xyyyzyxzyyz{xyyyzzyyxzyz{~|yzxyxyxzyyyzyyywwxxwwvwxwwwvwvvuvtuwvv|xuutttstrqrqrolmnnnlmolmllcKGEDDBBBBADpqC=:::>dyLJwssrrrsne^WWWW[ZWXY[[\YXXZY[[YYZXY[Y\[WUm}yxwvvwyvvx{zzyy{zyy{|xvhRFIIGHJIHJHHGHEHHFGFFGLNH@DN?1KSG2B=>KDAMLMKUU6>``JJQJCD]R9Y9JD58@^KX^O>H[RADFHTFT\VG550FYJO;1;FKkOJ?DXN?:8CJYJVMKFIMC?=?A>@?@ELQRQRTXXSQONPOOOPOPPONLMNNMNMMNMNNNMNNMLNLLMLLLLLLKLLLKJHIHGIHGFFEA=>>>>><<<;<:;<;86655555555566555644656666665~~~~}}~~~|~~~~~~~~~~}}~~||~~~}}~}~}~~~~|~~~}~~~}}~~~}}|}}~~}~}}}~~~}~~~~~}|}~~~~}|}}~~}}}~}|~}|||{|~{{{{||}||{|{zz{|}{{{{z{zyzx{|{{{{{|z{{zz{}z{zz|||zz|y{yzyzz|{zyzzz{zzzyzzyzyz{zxyyz{yzy{}}|zzyzyxyzzzyxyxxxywwwxvwxwvxwwvxuuvwvy||ywssuttrrrpqnpnoponnnnmllVGFFDEDDCBBBci?><<=:Drd8Osqwustttqf[YYZZ]\X[^_ZYWVXWZZXXZ[XZ\^^WRh}{xwusswxtv{zyyyxy{}|~zwlTEHGDDGECFFDDGDAFBFFEAMML8IKB0IMH9?HCEP^^UPTRWKBSHXKKAQhaWfhWIBYXYRXSPKV^^JU]][SQQ=7HM9QNL?@ACJ;KJIMCUK6FbUGQYEAI^FBM8LF7;9YI\^OBJYP@@GOYCRWNE944GWIJ<1AHF`VG7EaQ?67EGQIRKMJJIHA>@<@A?@?CCEHMQSWXZ\^XRPRPPOOOPPOPOPMNOONOONNMONNMNLLNNLLMMLLMLKLLKKJIJIIHHGFEC@>>>?>>=<=<;;<=;76646655666765767666665566666~~~~~~~~~~~~}~~}}~}~~~}~|~~~~~~~}}~~}~~~}~~~~~}}~~}}}}}|}}~~~}|~}}~~~~~||~~}~}}~~}}||z~|||}}}}||}}{}|||{||||{z|z{{{yzzy{zy{zzz{z|{z||{{|{zzzzz|{{{{zzzzy{yy{yzzyz{{{{zzz{zzzzyyyyzzwz{{}}{{yzzzyzz{yzzyxxywxxxwxxwwvwwxxvwvvxy|wuvtttssqqqooppooonmoklhMDEFEDEDBBCBS]><<<;:8MlD9c¿qoxvsttttj^YY\[^^[[Z\YXVVVXYYYX[Z[[_`^WPd~~}{xssxyuwxxvuuvy||~~xulXFBCADEBAADBDGC?DCDIHDENI8DCF2FIK=;KABEYd[NWVWM>RKPHLFLWdT`ibQGU[[QW[TH][\HZY[WJYT;:FJ8RQEB=AKI;<;VG]^NDJYHABGTYAQSMD646DRNK81@A@BCBCDEHGFMSW[^_`_YSPOOOOOPPOPNOOPPOOPNNNMNNONNMMMNLNMMLLLLLMLKJKJIJIIHHHGEC?>@=>>><=<<=;=<:77566556655676666767666667566~~}~~~~}~~~~~~}}}~~}}}~~~~~}}~~~~~~}|}|}}~~~~~~~~~~~}}||}}~}}}{}}||}||}{|||~}}~|}|{z{{zyzzzz{z|{{|}|{{|{|}|{|{}{x{{{|~|{{{{y{zy{{z{z{{|y{yz{yyzzzyxzzz||}|~~~~~}{{zzyzzzy{zzyxxxxxxxwwwvxxxxwwwyyx{{zyusutttsqsqqrqqppponkhXECBEEEEEDCCCHoT?>=<=;::PV9;njvztstqqpc][\\]ZZ]ZZVWUVUWWYZY[[Z^__[WSbyxzzyxyxvwxx{|~yvo[FCBAABCBCDABACACFCHGD>UE<<>G5GQK>;FDAAOXbVWZSI?OPIIEMZRa^Vji\JP_]SO_QGcX`KcZVNRXP9AMQ>T_E@@CTGELCN;IY<:JOOCYO;?KWGI@?D89==KH`[QDJQBFJA[TBRVLB638FNST61;H?RaD8FeQL93AFA@PTTOF?A7ERNDD5MJEG<7KD@NQSCMYUgneZW_b^WPl}utoonu}pnnmmllkkjkrqiqs]SPJGBCCBGFGIJJKJIJMT[^`_bdc\SPPPPOPPOPPPOONPOPONONOMNMNMMNMMNNLLMMONMKLLKJIJJHIIHGHEB>@?=@?><<<=;;<<:87656666666667676776776567765~~~~~~~~}~~}~}~}~~~~~}~}~}~}~~~~}~}}}~}~}}||~}}||}}}}{}~|}~{~||}~|||{{{z{|zx|zzzz|zz{{{z}z|}{|{{|z|}|{{{y||||||zz{}zz||zz{z|{{zzyz{zx{{z{}|}}{}~}~~~|||z}zzzzzzyyyx{wwxxyyyxxxyxzyxz}|||yvussstrrpqqrqponnljaGC@@FFFFDECDCDZyO?>=>;<=;;KE8Lļlgt~uqtvtqi_]\[^]][ZXXXUVSTVWYXY^\[^^\WQ]}}{xwyxzxyzz}}xuq^HCAA?BCABDA@AB?DEFBGJ8HB?<;A7CTI@=MCDX\P^W`b[KH`]RFaQGc\aPeTVLXXL=FRHARcL?AEO>AF=K>JN68LHIIWB;LQVCI>=C39>6DO\WKDFOGMLAZKCPZM@40:JOO[=1=P>NbB1TbOP94CIB?KQMNH?<>>>===<<<=<966666666667776676786768867776~~~~~~}~~~}}~}{}~~~}~|~|~~~~}}|~}~}}}}|{}{|{|{z||||~|}||}}|}||}|z|y{|zz|{|{|}{|}}{{~||~|}|{{z{zz{{|||{||{{|{||~z|}|}}|zzz{z|zy{yzxzzxywxyyzyyyy}|{|{{}}~|zxvvrrrssqqrsoomkhUA@ACFEEFEEECDAIgN@>>>=;==;;D9:kƷmhnxrwwwvqkd^\[_]ZZZXXXWUTVVXW\\^]`^]YOXy~|xy{~~}{|{z~~vpoaKBB@?AA?AB??@@AA?>CJDD=FKSIKN\C@BGG:EF@K@PL3;JJFEL=;SUVEE@>>6>A6CUYVLGIMJKEGOGCL]M>6/9LGT[8/:M?H^D1_cRV84GPH>LMNNTC8??R\GM>KPDPL8AHGEMMJ=YXdjeRg]`^VNbxtqonoxsplkkkijjijiimxrjnumhjgb`]ZUQNOLLJLKJJKOT[`bbdffffdc_XSPRQOQQPPPOONNONQOPPPPPOOPOOONONNNNMNLMNLLKLLLKKKIIHHHDAAA@@@>???>>=>?;886886766677777878777776797887~~~~~}}~}~~~~~~~|~}}}}}}}}|~}}|||||}{|||}z|}}|}~}}||}|}}{z}{}{{|{|{z|{||z|||{|}z|||||{}|{|}||}{|}{z{y{{{|}}{{|~~|~{zz{{{yyyzzzyyyyyzzyz|||}{yxz|~~|}~~~}}}{ywuvtsqprspoppcI?ABEFDGGFEEECCEXM@????===;;:<>@?>>>>?A@BBAHKGELHTNNT\LM=AEFFAMRYX_IIINOMD:LW`YYdeaUFWTXI[[Da_YQfZOUUWC@FJJRMUDD>IH8FBMMANB56SUNDF@=<9>D5GZYRGDHOJMS`MIBJVELM=:BGBRNM>>>?=>>=<866766677768768887978878766786~~~}~~~}~~~}}~~~}|}~|~{~}~}~~~}}|}}||{}|||{~}}}}|~|z~}}}{}{{{z}{{{|z|{z|z{|{}{}||{||||}|||}|}|{}|{z{y|{z|||{{{{{}~}~}}|zzz{yyzzzyzyz|||||z{{{xyxy|~}||{z{z|}~||zvtuuusttuur[E@?DFFFGEFEDDDCCLJ@@??>>==<=;<=:Súخjfiusvttsmfbfhg_\\[YXWXUUXWWZ\^]^\^]ZQVs|z|{}|{~{z}|y{}ywz~xomdREBA>>>>???A@?@EG@@FCDEK=<;D9JDPGGF9?GP=BP[Y_PFLNTKI8CIOXW^lkZIPSYQN\CabQRi^NTURL?DELMMOEDCNI7H;PHBMB7?QNOJ=:8SZMEE@:8:AO=I[WMDCNOLK:MNEKX\G;4-7PL]Y35@UQ@ZJ6dl]O;9ILA@SLPPTL=D?OaNDEEYIKL:<@J>PPNAP_\ieUhST[TOT{}wrqnkjifggjjkhiigjhgfdfjs{{qpxtljb\TQPPMMLLLLLPT\bdfehhggefinuwiZQRRRRQQQQOOOORQNOOOQQPPNQOOOOMPOONMNNMNNMMLKKJKKJJJIHGA?A@@????>>>==?=;966667777887787977876777867778~~~}~~~}}~~}}~~}|~}||}}}}}}|~}~}~||}|~~|}||}{{||}||}||}|||zz{||~~|}|}~~~}}~}}}~~|z{{{||{|{|{|||{{{|{~~~|~|~{{|{|{{~}~|||}zzyyzyy~|{|zyz{}}~~~|xyxzxxy{}{oPD@BEGHFGFEEEECBDGJBAAA?@>?<=<=<<;rӨ~kggzysuttrle_afegedc^[XYWWYYZ\\]baafe^STnyz}~}{zz~{yy}~}}~~xux}uhheRDBAB>>B@?@@ABCDC@BKBG>OF><>8;T^QHH9979@Z?H]VPFHUHOA=LVDT\[A9:-7LE_[3:DO^;RC9am`X=:JSBBRFPWKO??>M_RIGDVNKG98;I?JSOGKaYecWhPV[VQRrwrnmje_\^^begijkiihgfddjpstw{}}{~wqnppje^ZWRNONLLLLPU]ceefhijhgfgow}~zjZTRRTSRPSRRPPPQPOPRPOPQOQQPOOOONOOONMNMNMNNKLLKJKIIIIHEA@A?@@?@??>>>?>=:87668887787878988:779878867688~~~~~~~~|}~}}}}~}~}}}|~~~~|~~~|}}}|}}|{|{}}}}|||z}}{|}}}||}}}~|~|}}|~}}}~~{}{|||{||}|{|~{|}|||}~~}~}~~~~}}}{{{{||||zy|}~|||z{~}|}}zz}{~cGFFHHHIGEGFEEEEDDEJCAAAAAA?>>>>=?AR[Z`df^JQX[E]F\gRXkZTUVGF:AJPRM[KEBCDAG:NMKMAFBFKL8:C]@E]VOFNRJR>DIRD\YY?;<,;RCbT0BEJa

=bjZT;8E[LDNKR]MWE<@MW[GFDSOOK<8??<:878798978888888889988887897877~~}~~~~~~~}|~}|~}~}|~|||}|}~~}~}}||}}}}~}|{|}~z~|}}||||||}}}}~||||}|}}{}|}}}}||}||~}{|}|{||}{{{{{{|}~~~}|}~{}z{{{{{yzz{z|||~}}||z~}~|xTHHGIHGGDCDCDEFFCEDIDBBAAA?A@A>@?A=;_ÝwhcdqttpqnnmeZVY^]ejjhkklljigijnppppofYPd|y}|zurtv}yvtz~~zsnsz|xtmVFCGBBCEABFB@DBBAFCKG<=QIHC5G=KJMSEKE;HLH>EYZ_YODGGRO69@ZV[]_daPSX_JYH]fRTjQRZTDE8>ONMIZJCCE:FH^iVL98IcLENKW]OTF=BOV[LEI[QVM?6;FKGOLOE\an]]eO_UQUK_qnnlmhedcdcba_^]^`ceda`dimmoqrssrmjjqy~wqkfdhkhdehcWONPOT^ceffikkjhhlr{}xn_WSSSRRPRQQRRQPQQQRQPOOPQPPQOPOOOOPOOOONMMMNLLMKKKJIIFBBAAB@AA@?A@=?@?;87887:7889779878889878888779877~~~~~~~~~~}|~~}}}}~|}|}~||{}}}|}~|}}~}{|}}}}}}}}}|~|}{}}z|}}||}{|||{||}|{|}{~|}~{z|{}}||{|||{{}|{{{{|{}zz}}|{||{|{z{|}{|{z}|}~~|z|zkKIIFGIFDCCDDDFEFFEDFIDBBAAA@?A@ABCC=?~ĹtegcltpnlmnkiaYYZ]^^aaeijjkiiknprnopniZQc}|x~}tsqsx|wuy|}||}xlhq|~{zu]ICB>?C@@@@A=C??A@FT?8ADIM54>;GPC:OY^g\LKEKL<<@\MXdi_aYUMYUKJYfOSiMQZQHD8?NPHIRBCEN=IL=QJPJBGFFMJ=F@KSFFDK;?35B]FBTPKMMNQO=@FLF_^W5>9+>@@=:9788889977879789:97789:888978:8~~}{~~}}}~~~~~}}}~~}}~}}|}~~}~~}|{}}~|~|}}}|}}~~}|~}}~}|}~}~}}~}}~}}}{~}}|~{|{|||z{|||}{|}|}||||{{{||{}|||{{yy\NLLIHEEDDEDFFGGGFFEEJFBBBB@AABABBADB=Mºrcedjsmmkmmkif_]]\]]\]_badd`dfkmojkklh\Pa~~~|wpmry|~~vruz~z{|wifo{~~zbLCA>;>@>?>@?>?CA?BK9;DDCO:><65?QXMBRR>AKK=@TLO[kdZ]dS[^MPPdQSiMTXQF>=>STRMKHDKWGCJ_e\G59Y\GMMNRaLTI>BNJ^MIDYS[PG::?LGPLWG[jkZf]LmaRXNWnnnlleegedddeccdbc_\[\\[\_bhjnnosrqnonjhghihhda[Z[YWY[Z^dfillhghmu~}{|vndchjjbZWUTRRQRRRRRQRPRQPPPPQQQRPQOPQPOPOOPOONNNNLMLLLJIKJIEAACBAA@??@??>@?<:;978987988999:99;;87:9899989899~~~~~~~~~~~~}}~~~~}}~}~}~|}}~}~}|||~||}~}z}~~~~|}}~||||{}|}}}~~}~}}}}}||}}||{{}{y{{}{|{z}|}|~}|wv||}~|uSONMJJFDFFFFFHIGGGGFDGHEDCDBBAB@ADEDIA>jûleccivniijhhigcb__]\[b_a_^]]`bdgiggggfXP`wz|}ztlkszy|qjnz|{|zofmx}|gOFC??B@AABA>AEFB?HJ?@ZU`^^VQML=AQRDU`pa^^_Z^RUMcSReUXVVE?>6PWPLGNFOPGC=BJHTFGE@IVKIFBGEIHDN=84;CbIIKOLILKTE7:FAMPdN7I7-PJNSSLXlg]kYHpdRVMQmpolkeedeeeccccbeeca_^\\[[^`djklnmmliigdba_]]\[[][\_^^__dkmjghjp~|wwp^WW\\bc]XXUTTTTSSRSRRQRSRQRRQQRQRQQPPOOQPPPPNONNLNLLLLJJKKGDAACBBBAAA@?>?@@<;99:7888889:::99:;:99987:::::::9}~}~~~}~~~}~~~~}}}~~~}|}}~~}}}~}}}}}}}~{}|||}}||~|~}}}~~}}}~}}}}}~||{||{{||{{{z|}|}|}~~~}{}]NLNLMKHGHGGHHHIGGGFFEDKHDDCCBBAAAEGGLJ>Cƿjcebe~|jfhhjiggegie``^`cc^_b_^bbhiihggfZS_yvvx}~|{xtyupkswtzslq|~|}|vnpxziSIGECCEBCDCEKJCBIBP5@D5RVd`[c]Yf^YI`TNdXXUXF>E7NTKGKODLMLK=FMHUKDB>OTJFCAHDKE>M?<6>EkIBLOIGKMUA8;F@RUhG?H5->HSa?ARP8NI>?<`e`>3AhYCHGPMT\HLCALRS]DBTSURF8:AA>;::99:99899999997:99:9:9::9::8999~~~~~}~~}~~~~~}~~~}}|~|~~||~|}~}~}|{~|~~}~}|}{}}}}}}}~|}}||~|}}~~}|}~~||||{{{|{{{|}{~}{|}~~}}~rgYPNMMOMLHGHJHIJJIGGGGFEBKLDCDDBCAAABEFIMFQS[]b[RY>EFAHRWaXZb]Ub^[ibP_UXWfIBG8S[RDJN@KMEOH?HHZK><]i`;3HfQCEDLPT`DMFGIOT^G>SVQND9;>TNGXNNQcg_qXMkaOVJOmviddfeadecbd``cabdbaba`_\^`b`_]^^]_^abcaab`aa`````__`djipy~~s`UWUO]haYUVWWUUVSQRSRRRRRRRQQRRQQPPQPQQPPQPPPOPOOMMKMKJJJIFDBDCBBAA@AA@?BB<;<;99999::8:;:9:::;:99:899::::::8~~~~~~~~~~~~~~}~}~~}}~~~~}}|~~~}|}|~}~|}|~|~}~~~~~}}||{}|}|||x{}|}}ze[WOPOKLMNMKKKKJJJKJHGGGHEBFLGCCEDBBBBEEEEJMA>plzˠp`adk}heffhdfdccechhgeb_^_^`_cggkilkgg^T[s{{yy~zxvvplnoomnu}~~yyz|}xuysYLGECBGGACDECFKAGJL<:A7=MJ@;@PQB8>VUNL@H\:FNK??WYT[cQNM?HD=KRd]V_dacYV`eWgb^]hHLP8OWQDMKDKPBNMDGI`NA=?[LGC?BLKNKGMB?<;SbJ9BU@IOQI<9CTBO\`;H@34>H^R?PML9YG;==_o]:6XfMHHGPWL^GJFJHMRZH?SWPOD;=@WKDWLNKbiarWOfaOTJHeyhdbcbcbcddcaa`cedbbcccb`agmg_aaadbbbbdacabcbaba`a`_`ehky}~}vcVTTNV]VLNSVWUTUTUUTUSRRSRRRRRRRRRPQQPPPQPPOOPOOOMLLLKJKJIEBDBBABBA@A@?@A?<;:::99:::9999:::9::::9:9:9::9;99:~~~~~~~~~}~~~}~}}}~}}~|}}}~}~}}|~|~|}~~~|~~}~}}|}||}~~||{}~s_Z`YSROOMNMMMKLLKKJJJJIHHHGDEMLDCECDCCDDEFFJNK?Jpei¬ֻab_g{hcedbada``_`egjic`_[]\dgggjkkjghbWWq}}trx{z{yvvslkkkknw}}zz|~|zvxv\IEBA@@A@ACA?EFCGDD>=F5;OKB2*@RNJ=DVSKJ;[O>JPMCGY[YZZLNJHK?BS^e[Tb_kaZ\aO\[bafCPU8IPNDKIDGOCOLMMD^LC@BWLLE=@IWVJEJH@GPFQc[;J>24@LdQB]JL>YD7=BdnR8UD:>DfiG6@bgHLABJdVRHEDG>GO]M=P\NMD@=DWG=UPQN_cdmYXa\KHJL^koidcedcbbdccccebcbccaabbbdgr~rdddebabbbbbacbaaaaaba```bhku{z}zwqhc^\`]Z[WQOHGMSUWVSTTTTVUUTSSRRRRRRRQPQQPPQOPPPQOPONOMNMLLLLKGCBBDCBABBAA@?AA=;:;9:;9;9:::::;9:;;:::;;;:;;8:9;::~~~~}~~~~~~}~}~}~~}~}~~}~~~~|~~~~~~{~~~ye_^cc\VTRSRPOMLNNNNMMJIJJJJHHJIHHVPAEEEDDDEFGFGILQN_W\tƻѷ|a___uxc_`\^cb`^]_^behhfeab]ZY^billlmkngZZr}y{|{y{{zvssrpptvx{zy|~yy}{yz{}w`NFDAA@?ACF@CJDO>6GchIM>JL_YOL>GJ:?NZM39?fjISmMWBIDEANmf6JYPIF;=GWP>PPUUWebeXZ\SFHOMgngdbedeecddddeeebdbaaabdedel}yfecabbbcbdbbbabda``a`a```fkn{{yxwtqdWWZ\`d]YY`aec^\YYWWVWVVVWWVTUUSSSRRRRRRRQQRRQPPQQQPONONMNLLKLIEEDDDDCCBBBA?BC@=<;::;:::;:;::::;;;:<;;;;;<::;::;9;}~zg_`c_\ZXUTSSRSSRQQPOONONMKKJIJJJJHEGN]SHCEGGDFFGHHFFYmХv\TMPe~»̵}b`]Youc[Z\___^[]]]_aceilga`abee`cgmnospbds}}zvvxytqmjkpvwx~{y{|}wrruutty}~gOHKKEFKEIJHHINN?;;MR<3AAHCDC?9HHBJRMLKRaYC=L[feOEDAEMV[SPPBBJMb]Y^QRaPM`U\[ajIOiJ;XTG?NEMFFQUCVgD?FE>:HNHRLKDDKPFR^iGCAD:;CigGZiMREIEBDPl\3:RhWSP8BYaZRHFWT9CRmV7:[hMTG7DZ^WUIH\[<;SbNBOeNJB;@HVV@MPOZM^`^V][VJMMagofgdcccdddddddbdceedddebddiukcbdccbcbbdccadbbcccabb``dikx}|||yjZ[[\[_dktwxwod\Z[ZWXWVUWWUVUUTTTTSTTSSRRQRRRPQRRQQPOPOMOLMLLJHCDDCDDCBCADABCA>=<;;;;;;;;:;;:;;;;;;;;;;<:;<;;;;:9:}~}~|~z|~~~~g_]^\ZYX[[XVVUTSRSSSQOPPOOPNOMMLJJHEEFHITg]JJIHIJHHGGGHJ`˕hYWRUSWg¼ysosttvy~~˫s`_[\iq`YYX]^_]\Z\\^\\]cefkpojfdcecZZaoxn]fyx{||zywsonnoou~yvx~ytusstrtuyzzxwgPFEAAAA@F?ACFPBA=6DCFEBDJBBDHJ79JCKVONOV^`L?DOi_OJXTF=FRNQ_eXPYaWPgZVNKO\Z[blKHcM>CNFELHPRHMOBKRiUDDJCVSC?AXgAFDACB@EN^NEESDKPNDDTIRKpbGEBD9=Oo_GilMRPA@U_KELhSJ@8CHSYFKNM^M^[ZU]ZTIJN_ih`fedbeddceddcbddcecdcaddgl{mdbbabdabdbcebcbcbbabca`aeikv~~}}zl[WVY^gt}}zxsf]\Z[YXWVWWVUUVVUUUVVUTRSSSQRRRRQSRPQPPOOONLMMLIEDFCDDCCCCBBABC@=<<<;<;;;:;;;;;;;;;<;;;;<;;;:9;:::;:vv~~~}}~qd_^\\\[ZX][WXUUVSUTRRSRQQPPNNMNNNLKGEEIJJQeiTKJHHIIIGGGFHR}ӽd]\[VOLYmsnkjnotwx|}{~ɤm`b^\hpa[XY\\_`^\[[[VY\_cgmookkfae`\Z\`ki^bvzx~~|yzwsrpoqzzvy{wvutstqtwz{zzzkSFBA?@A@C@BDJJ@AB8@CCGQLLI@@QQ;638FMQURKUWVD>CRZWEJW]UFBGEBK][ZhgZ`bY`KE^W\^iNH[PF@JICKINSMMJADQkSFCULFLF@H`\>JC?>FCDJcLGEPGMSSIK]ITMpTFBBH9?Sr\JojHQU@D?GZnH<@f_\^;=Lh]^TDK^Y>?Z\JHMgUKD9DFOXFEPScMW\WT[XRHEM]edcfbedddccdccdeddcbdcdcdbgp~qedccdbcabcaaadabcab``a`aciku~zp]VZ^lzxf_]ZZYXXVVWWWXWWVUVUUVVTVQSTSTSRRRTQQPPPONOMMLMHEEEDDDDDDDCABDC?<=<<;<;;<<:;;;;;;;;;<;<;<;;;;;;;9:::{wvx~~~jbb_]]`^[YX[ZWVVVVTSUUSTSRSQPOONNPNLLKIHJJJLZncOJLKJJJJHHHKMdӳ~eb]WOKNSaywihhjosvz|{y|ǟnc__\gnaYXY]``^^[[Z\XZ[]egjnmmlid`^^[Z[\^[[p~~~~|xxvvuty|vxzz{zxxvtsqswzz}{}nXIEEBAABDBEEHJA=C5?MI>Ne]PIKKNJS?06IHNLON[TE9EPQXG=GO_VNHGE@DVT^bgVb]^_N[XS^eNKZTQ>EJAIHMTJNPBBOfNG?XYVDA@I_UCMH=:HBDMdNCDOGNTSLK\MRPnRICGM7@WpXQr_IUU>GCF]h=>Ed]aW?=Yn^[SDNbY;?[YNGKdUGG;EBLUGDMXbSRYR\[^SJAJ_bfbeeeceedeecdedededdddddditteddddcbdaccaaaaabccbaa`abikt~~}}}{td`jpz{ja\][YZYXUWWXWVVVVUUTUTSSRSTSRTSSRRPQQPPNNNNMMLHEEEEDDCDDDCADCB?=<;=<;;;;;;;;;;;<;;;<;;;<<;<;;;;;;::vmot~}vfbb]\^cf_[XYZYVVXUVVTSSSSTRSRQPPPPNOMNMKJKKKLTfmXNLKKJKJHIIKNT{Ρwd`WPNKORfuhfhnrvx{{vØk`]]^dkbZYZ]`_^]ZYZZYYX[cfiiinlid][[[[Z\^Y]m~{{xzxvsw}vssuzyxvutuxz||}}pYKHLFCHKFCKJIMB9LHPF9MHDDMLP^O=?IR_]:;FWSLPKKCGGVZ[a]Y`R^SQbU[gOG]Z]FAFBEJKTFIQJEVYLJDSZZTE>GXYFEH==HEILZHADJFJVWNKTQOXmQH>QQ8@ZjRZp_HUUAZseYUBZf]?FBIL[I@BGGITVMOWRJekQI>SM9A^lT[rcG[U>CBPd_;BXev`K?CWyfVSE`f[BBdVSJOfXIB>C@QTJIS[iVOXW_Y]LBEOaf]`deceecbdecbddcebddedddfp{idedcbacbc`bcda`cbab`aaa_gin}ogo}pecbYYZZXWXWVWXXWVWVVUVUUTTSRSSRTRQRQQQPPOONNLJGEFDEEDDDCCBBDB?=<<<;;<;;;;;;;;;;<;<::;;<;;9::::;;;;:}wijmrwwwiacc`]_cijha[YYXXXWWUVVVVWVTTSTRTQPPOOOOOMLNNLMLMWfj]SMLLKIJJLLMOXlպh_WRKJkǘtjmqtvxxr˽f]`Z[hkc]YYYYY[\[\[Z[YY\`ceghjlhc_^\YY\[]]][]jz}||yy{zyz|{|zzz||ywvwz||vaLHGEBDGDAFBECEAEG?LGOQROMYIEOE9QK;-19BACFFLR?BCD[WTF9ICDFAJHNH?DIFHNSPS^NFjiOGAaoW[rhI[U@=DWd[=E\hwaGDF`~fWNMbfYFCfUVGQaVJ@A>=WWLNTajcOXY^Y[JCKQ_f`dbdedcfeedfdddeeeeddeeeiskbdcddcbdaccbbbceabdcaabbgin{nb]h|weY\`[YZZZXZYWYXYWWWVWWWVTVVTTUSSSSSRRQRPPOPNNMJGFFGDFDDDDDCCDA>>=><<=;;;;;;;;<;<;;<;<;;=;<<;<:;:;;;;~|ywnkopwvz~kfcffa^^bgjjhb\YXXYVWWWWVWVTVUTTRRRRQRROPPNMOONOOMMQ^nhXOMKJIKJMNMQQ\|ФsaYTM[ĒqmrwxvsoǷc]_[Xgmc]ZWWXYYYYYZXYYV[acfghjhheaa[[ZXZ][ZYYW^p~}~z|}zwux|{{}{yxuvy|}|vdOED>=@C??C=DFBBLLLOGNQOPKLK:4:3=P>4.66DBCGCJP=KDLTUaV;:?7>ASPIKOT^fcLROWPbea[JJQ^YG>CDKRRPDWVCUQGJGN\RQQPMW[D=DGCA=HFLQ?EIINTWQXZLJkdPG?\HF^QLIVkhdNW^_YUKAMP]cdddbdecedddeeedcdddedcdflwndbdddabdbbedcbbbbbbabb``chlwmjg^^h|v^UZ_\ZW[ZYYYYXXXYWVVVWUUSUTUUUTTSSRSRQQOOOPNOMHFGFDEEEDEDDBDEB><<<<<<<<;;;;;<<<<;;<;;;;<;;;9;;;;<:::}vvw{yrlomxxwkdggeb_^ahjllic\[XZYWXXWXUVVWWVUSSTSRRSPPOOOONOOONNOPXfodTOKKLLMLNNPRUečh]VVyغqsuvussŨwe`]YYlma\[YXXYZYXYYVUXX[]abfighheca]XVVYZXY]ZVTVfw~{z{}|xw{}|~|{zux}}}xePFE??@@CBFAEEEHMFOJKLRQQPUVK855/MA::3>>EDMMENF@RGOGWoQ=@=FGjlX_reR[M@>KD4Q8BIBBJU[TMAEGWFHhaMA@IFCTC]hYX[T\ZIP\RYddSBJ\XYE=<<=<<<;;;;:;<<<9:;;:;<;;;;::;;;;;:::xqkkqnqommu|{oiijkda_``bjmmlkid]ZYZYZZXYXXXUWWXVWTSSTSSSRRQPPPPRQQTQSTYiph[QPMLNNQPQQUWbϸrȮџwsuqz˺nif\V\qi\]\ZXZYXWXVWWXZYXX\]]`a`a`aa^^ZYYXWXWXWWTQPUdxzvnt}}{z~{}|~}zx{yy}mVHDDDDCGEIBB@EACVBQSJVVXTEBX`E8BFG3PIGWEHJRbcdMCDPMDae[PIEFDLHJb^U^`UZTJORL]]ZEFVX^U=AGMNQJR[KIUXLGKZTTRJOT^QAFFDECFKGH?OFLYQZOYVOZoXMFQdD@EeeVfqd\SK@>[efBKelvrWFM_qqeaQX[iFHQ]W]@PaPG>P;V_RPJah\VOf`ZVNFLVNSaedgeddedeeefffeffeefceglwtgcdbcccbddcadddbcccdaccbcilu}zxuobZ[_dhb`fzzk`Y]\ZZZZYYXXYXWVWWWWXXWWUUUUSTTSSSRRQQOOOMHGIGGGFFHGDFDDFC?><=<;<;;;:;;;<:;:;;;;;<;:;;;;;;::;;:::~}vqlkjhijimty{z{omjikklfaa`_aelnonlje_\YZYYZXWYXXUWWWVVVTTUTTTRRSPPPQRQQSSTRVcmnaVONOQPQRSRSVYjɳrpxĨmke]V`tj_]_\ZZZYWWWVXYXWXZY[Z]^b^^^_^]]ZYWWWWWUXVQPMQ\o|vqu||spttutuupoqtssyoYJFEEHGFJHFHGCBELFKTLRYP[KAIZM8=:D9CL6GYJPM^kv_N<=<<<<;;;;;;::9:;;;;;;;;<;;;;;:;;:::xyxyxxqokhgikjlstwy~~vomkmniidca``^_bhnppnljda^[ZZZYYXYXXWXVWWVVUVSRSSRRSRQRRSSRPQRSV_epj]SQPNNPQQPPQU^oŻզwzŻqlhf`[lmaa^[ZYXXWUSWWXXXXWXV[]\^^]]]]^]Z[WZZXYVXVVSQPOVhw{wy{{sortstsjbenuxrqoZIGGGGGHILFHGDAKQILPSV[HTMJL\XJG?GM9T<4]KMMXnoq]E:=8NY`OUVTFCOKKaTSVTQJ^k_NF]bF?=[i^mo_cTTCFhgaELhsrnQMQmsj]V\Y]fIPLPeU?T_LAKX@Z^V_]^YcTO`bOXLELWQX`ffeddedefeefeeeeeeedfeisyicdcbbbccdcbccbcdaababacbglp{~}yywsoeYZZajtuvybXZ\^][\[Z[[ZYXZWXYWWXVXWVVUUUUSTSTSRRTRPNLJHJGIFFFFEEDEGE?=><=;<<=<;;;;:;;9;;;;;;;;;;;;;;;:;;;;::xvwvvtqqokjlloqrstu{}xnlmmjhgfc`a_`_``dimqromlg`^]ZZ[YZXXZWXWWWVWVUVUTTSRRRSSRRRTTRRSUY]hroeZRQPOQPOPQOTX`n²Ĝ}pmlfae|oig`]^]YYWVVUWXYXVVWVYY^]]^]^^^]\[WYXXYWXXWVTSSQS`o~{z}~|trz~}ugZ`lxwsq]KFFFFHFELHHGC@HSKRRSRcAMQDK^XZWGFT:KF@PUMPUkuqmVE6?LRSTP[SOHEEQITWLLdd`eOEMJRP@OSgaWDGKRJMHUWMU^VLOVTRPPROaY=@NCKRQZXTAKKG]RSTPNKcfYLH\XH?>]k_ln_dUVBImd^HPjqqiLL[qx_`VdWbfJPJPiOAY_L@VNBW\Sj`[^XSP^cMUGCTVMWeceeeeedefeeeeeeeefeeehlw|lddddddccccdedddbbc`baaabglmz|xxtoi[Y^gvyjdv|f]^^^]\\\[ZYZZYZZWWXXXWWXVVUVWUTTSRRRRRQPNKJIIGIIGHFFFEEEC>>=<><==<=;;<;;:<:;<;::;<<=<;:;:;::<;;:;xvvspnvvrmnoputvuvuz~zomlolgeecbeca`a`abfjnpqpomia^][[YYYZYXYXXXWWVVUUUUSTSTSSTRRSTRTRVWZ]gkslaVSPQPOOPPQPRVWaɼưrnmkgcjrrmg]__YXWUTVYYXXZVSWX\Z\__\]]__[YYXWZXYVYWXUSRTRPUk}~}z|}~~tu~qcZ`ivzts`LEEDFGFGHMHEFCBEIOOWU^LU_=G^[^YLOO>I>CJXWMNcnltiQ?;IXZWSOOOQYLIKDRQJRge^cKHLFQ>QSab[KEHUPMKRZMR^YLRQTSNOVL__[pcim\aSWDSog\HUppuaNL`qv`eZhXc]KSBUhJ@]]H>[BGXPTeW[^OOOW[JWCNYTJWebfefeebdeegeedeeeefegio}}oceedccddeedcecbebbbcaaabekoz~{wvrh^^m}q\[podfd`]^]]\Z[ZZYXYZXXXXWXWWXWUVUUTTTRSQQPQOLIIIIIHGGHGGFFEC?===<<==<=<<;;<;;;;<:<;;:;;<;<<;;:;;;;;:vwvojnrwqrppru|~|{smpqqleddddbbabaa_adglnprppmjc_]^[\[YXZYYXWWWVVWVWVVUVSSSSSTTSSSRTUVY^a]lqh[TQSPOOOPOPPPNLZƸƴ{rrljfdrssof_]_[YWTWXXVYXZXTX\\]^^a[[\\[]YWXXWYYVVWWVVXTTTTTbw~~vusjiouzzsrbNIFGHEEDINNHEBEGDHOVa^VWcVXdiTYXYVMUG=PU`URXqbo|^P9@RZ[_DIHHWYRJINYOOWbc`\GPSQPJSZ^hQEEL\LLO[QMcYMPLNSRRSO][=ASFDVSNZZLUPFRNYTUNQecWKCfXJG?cthgj^aWVF[pk_I[nnxXNOdsm_c_kU_RNQFahED`YK=Z=JWQZ^TfRNXN\YLYCVVQIUfefcefedefefceeeefffegjr~qddeedddddcdeddbdeccaababcknw}zwwtnjtm]Zjzrkd_^^]\[[\[Y[ZXYXYWZXYWWVWVWUUTUSSRRRPQMKIJJJIIHHGGFEFE@><<=;=<;;=;<;;;;:;;:<<=<::;;;<;;;:;;;:;=====<=<;;;;;:<;:;;;<;:;::;<:;:;;;:;;;<=>>===<<<;;<<<<<<;=<;;;;;;;>;;<<;;;;S]XdMLHF==>===<==;<<=;;<<<<<;;<<<;;;<;;<;;;=Y=UXgV_WNQS`bQ[N\GZWRHNZaeffghhfdeegfeeefgefhmw|{vjdfdeeedddddeeeccbdbdcdccfkr|kZY]gwi^_ddb_`___]\]][\[ZZZZYYYXXYVWVVVTSSTSRROMLLKJJKJIIIHIGFB?=>?>><<==;=;<;;=;<<;<>;<;=;;;;;;;<;<<=<>==>===<<;<;=><;<<<=<<;;=;;;;;;;;<;><>>=><=>=><<;;<<=<=<=<===<<;;;<;<;;<;;>?>>=>>>==><===><<<<<=<===>=<;=<<=<=<?>>>>=>=<=<==><=<<>===;===<<=<<<<<===hhgfc][Z\ejqx}~}tuxusnlkkjjjjiihhhggffffeccdcdbdikquwwwvwuqplfe`_]_^^\[[ZZZ[YYX[Z[[YYXWVWVVWXXX\g`VXYXZ^`akqm^UOPNMNNOVŻohed_Y\w~ooqopqpptukdaaa]_``^]_`_aab```_`a___`cea`^_abb`_eejjkigffeaa`^]YWRRQSSTSRQXk||{y{}~r\LJIIHIIIIIHHKLVd]SP\cbcanms|wwwsrrsobj{zcahjQlpgXUZ[H@?MODIPKTYVDDWbLVXUMVLBEGAFMZPVXcTJQQ[bQTTUTSSIGQLRqe[afKKVYIX]ZYZjjcWO[]WeeK\si^fabVYygk]^osdX\X\^thliaYONUM[kZJWPBUDNQgUNOM[_YZXTiga[VKOOXaghhgheeefggggffffhffiq|~}z{zwqieedeedfeeeddeeceddcbccdeflvufa^aog[^acbaa``^^]^]]^\\\\[YZZZZYXWVVUUTSSRMMMMNMLKLIKJJJHECAA??@>?>>>>>=>?>=>><>=<>>==<>=><<><>>==<=>kkjkd`ZZ]bkr}}{|xuvwupmnljijkiiijjihhgffgefdecbceeijqwwwwvwurnmifa^^_^\]\\Z\ZZZZY[[[Z[YXVXWWWXWX[_dZXY[]_]_bhqofVQPPOOOOm¸óvf_`]Zdunkloosqrrtpdcee^_`_`__``__bbaa`deaa_aefdb`bfghdgjjjjmiihkhfdbc_\[XTRPLNNLLSg{}|unnqtstkWLIHIJIHHHJIHJKPWUMKO``aaomxvxwqtqhbrx|qhmoW\kreQU_ZG<>HI?IKMS[VJAVbVVXXVTI@CABERTOPXdHKNZdSPRWTTVIKOMKpf^[jQLT[GW_ZX]kf]XKX\YglRVqi^adcWZyil]\prcYZVXeuhph]\LVSSYkQNXHIPAMVgLOMV_\XZZTiidZRJMPUbfggffggegeifefefehghms~~|{zxxskeddddeddefddeededccbddbdfks{xseW[amncgigdca_`__^]_\]\][[ZZZYYYXXXWWWTUSTQNNMLLMKKKJKKKJFDCCAA?@>?>>??>=??=>>=?>>?==;=<=<<==>===;===>mlomgb[[\ajty|uwxwrnknkmlmiijjihiihhgfffefefefcddjjpwwwxwxxtpnhfb`^`_^]\][\\[[X[Z\\\[ZYXYXXXXYY\d`YZ[]^``adgmqk^SQPPNPVý´gb_\Ylpiglmrsrsqrojdddc`]^_`[^_]]bdacedea``bhhghefhhhgjjjikhiihjikfgdb_a^[WSRPMMLQ[fieea[X[]_\ZSMKMNLLKKLNNNOQRUVTTUbafijm|}zrrtqfnvyqtndcgvw[MU[UBDFJBBINSS^YLIOPb^XXXTIIDFIJQQNJd\KM\hWOPXQVZKLLLGgj_ZlXJP]IS^^XZggZXLVX^iv[Rwm_\ge\]zhj[]qwaZ[X`mofrf\XM\NX[jHOVFQGHQj[KGY[_VZVXWiieZNHOTYefghfdgghhgfgghgehffinv~||zxxvtkfdeddddddcedfedcdeecccbcfjp}zuqqopbXbm~xvpidaa```_^]^_]^Z\\Z[ZZ[YYXXWWWVVTTQONMMNMMKJKJKLJFCBBABA???>=?>@>=>?=?=>@>==<><<>=>=<<=promifa\Zalxyuwvtonmmnnmkkmkjiiihiihgggggeecddefghlosxyvvwwtplljc_`_^\]^\\\[[\[[[Z[][YYXXYXWVXZ_e^WZ]_`bbeffjmmbVRPRQQoÿöj`\X[ymifknpsutsqnmheega]]_^]^[\_dceeecbbc`eikjkhhihfghjheddeffmkjjhfaa`]][ZWQNNMLNTXVXYWWZZ\[\^[\^`]]_^`baa`bbccccefgngigt{pruhm}|tmffo{gQLO]NBDOPGCIQJX_[OMKP^`\[a_UPNLLJKJMVaQN\eWQO[RT^LOMNI\ocZjcGOaMN`_WZbeZZPVX^iufQswc^fiZ]}nn]`vu_ZY\eqmgse[RSYLYbgHVTGIHP`pOPU`[ZUZPTajgbWGM[X]gfhhhghhggefghfgfggfjoz~||zvvvtldeeeeeeededccecedcdcdbcdejoxzvroprslhq}sib_bb```^_^^^]\\[\Z[ZZYXXYWVVVVUVSOOMONMLLLKKIIJIECBBAA@@@@??>?>???>?>>==?>>==>>><====>>>>=><>ptpomgd]\cl{~yxxwsonmmnnmlllkljjijjghhhgffffeeefdfiilosyzywwwsronjca___^]\\\][\[\\[[[][ZZXYZXWXY\ee\X[`aaefffhhnphXQQQPZÿ¼ķt`ZYbzoigimqtpqsrnmkgced]_`\\]^]`ehigeebbeefklmmnjhghhghfecbbbgiijkigedc^][[ZVRNKKKOYbdeefgfhgghghffeddcbb`a__^^_\Z[[fnhpm}zvotmkzz~rphjuq_IJRPB?>ENBFDMWV]\XOHDR\Wif^WGEIKPNOPXTQ[eWUR\UR]MPJSNUpg[ekHNbUM_^X[cbVYQVZ^iunPoxfaknY]qqb`xr]][`goohtc[Q[OO\n^M\IKDLTl[POcZ[TV[RVgig`OET]X`heghgfhfgfhefffhehhhls~~|zywvvunfceeeeceeedededdddddecdeejmv~}{}~{mhwqeb^_cbaa`^_^^]]]^]]\[ZYZZYXXXXWWWTQPPOOOOMMMLLLLKHFEDCAAAA???>???>????@>????>>>>=>==>====>??>==mqqrpjd__bk{xuwxwspmpoonmmnlllkjjkiiihhggfiggffeffgikmnsxzxxxwutqpmf__`^^^^^]\]\\]]]]\[[ZZYYZYWY]^faZY^`cdehgghgkqj[RQTQqûþƹd][pukkhimrsrtsrrmmmffc_^^]__^^bfehiieb`achklmnkkihfddadfdbadjighijihgf`_]]\XTOLJJGP]babaa`]^\]XVVSRPQROLLKLJKJHGHHIblnqtzpxrqpmqx|q}ogpvuNGNVN>;8GECHGN[YVbaUKBMLUgj]\RHLMSWPMXMVgXRVTWP^TPKSURnh\anUMaXJ]bXZbbWZRV\[irtVezf^jq][}so`bwqZ`]dgmnfw_WOYMTcmPOPFPCQbdIK_^Z]OZYTWhii]IMZ]Vchgghhhighhhhggfgggfiow~}{yxxvutohfeeffceedeeeedccedcccdeeilwrg^^oi]_abcccc`___^]]]]\\]\Z[\YXYZXWWUUTROONMONMMLLKLLKIDDBBBABAAA@???A@@@???>?>??>??>=?>>=>=>@>>>>>?kopppkd`]bhvvuyxurpppnnommolllkmljjjijighhhggfefffhjklnmqvzyyyxyvtsmg`a`]^]]]_^]\\[]\^]]][ZZXX[ZZ\bg\[^bcfgggihkklok[SRR\ƿƼq`briliklssssrsspnumge^\\]^`_cefgiiidccdehjkmnliigeababe`aaiijighjigghc^`]YYXTRPLJIJNNOMNNMNLKKIGEEDDCDEA@?BCDDB@AC[jeqyzy}otvofiny|tzmjhw}aRPOZCA>;CGFIHHUXSbje[KGLR_e\_UGGMPQMKHKa^MVPWN^WRRM[Nhjbam_KYYJVd\X`cX[[W[\grzbY|j^gue[xusddyp^a`hjpnkv^VTXPWieKVIUKLZjVLXgX^VQaSRYilh[JY\ZXfiihhigiiihigfgfghhhkqz~~|zyywwwuukeeedddefeeedceddecedcbdcgkvn_[Zaqk`dffdedb`a`__^`]\]]\\\[Z[YZXXYXVWTRPONNONONMMLLLKFFDDCBABAAAAA@?@>???>???@>?>>?>@>>>@>?@?=@?@>>qkmqold`\_hq|uuvutrqqpppnonnmmljlkjjjjiiihgfhggfgeginnmmnmouxzyyzywurqh`b`_^^^^\]\^[]]\^]\]]\YXY[\Z[dd[[_cdhihhiijlnqn[STTvξ}co}mlmjosqrrrsqppostjg_\\\^^bceefggg_befighiknljhifccddfcbfkmkiihihgghd``\XVVURRPPMIIJLMLMMKMIGGFFBC?BB@@?@ACCEGBCD^penvn|{ostohfnxzpljdlo|maUPQM7AJIHCLTNSahplbQIG]][`\NGWRNRJDVdOWTRRZ\LRIbObi_clbNW\MQa\WbfZZbUY[jqxpUtn^jvh\vxrgd{h]`eklplmt]VWSTYl[MTMSGXaaLSi\^ZLU^NV\elfXP]XZ]ihgggihiihigighggggilu|~~{yyxvvuxxmfeegeeeeededfdecccdecdcdgjtkX\covlpoiedcba``__]^]]]\\\[Z[[YYXWXWWVTRQOPNNNNMMKLLKIHDDCCBBBAAAA@A??@A?????>@?@?@@>??>>?>>>>>@>>?@tomkkgd`_akryzvuwtssqsqqrpoomnmlnmlllkiiiiiihigggfffkorsplmlotxyzzyzzxxtgaa`^____]]]^^]`]^_^][ZZYZ[^\`ga_`accgihgjkjmlpscSUcŹ̶IJw{mmnnnrqrppvsqrpqsrh_]Y[_bcdeeehfeacisrjhhkmmkkikjgefhgfghkkjhihikhjha_ZYVSRTSQROMKHLNPQQQQKHFEDCCBCBABB@EDDDFEEGisojtr}|zmqwtmmuyzmkofqr|qe[[KRGAHC=DMEBLQTJTZmrji^X`_`\^SKKUPQXJJaTX[VPXbNUM`V\ibenfRUaNP]\Zc_`YgXW]ktvxYhr]ivn\o|qedza``jjmpjprZRWXYciQPMSHNX`ZLdf\bUIXXS]afkbPX^X]cghgghighhgfhhghhhiijow~}{xxxxwvzxkgfefeeffdeefeedddeddddedhkrraesxmcaddbba``_^]]]^]\\\[ZZ[YXYWWXVTQPQONPNNONMKMKHEDEEDBBBAABA@?@?B@@@A??@>@?@>A@?>@>@?@????@@?>xsligfedaclqzxuwzvuurtqqrrpppmnmnmmmklkjikiiihhghgghjotvtsnomnswzz|{zzywvgaa`_____`^]^]\^_]^^]][[Z[\`^ff[]`_cedhhijllllmpvf_ǮǹxopprnqoqqsrrtqprrqnaZ[\^_aceffefderzxqlikkmomoonojggihggfijjeeefighgb`[XVTTSSTSSSQLJJNSTRRMIFECCABBB@BCCDEFCCDBGmrqmquyy}rlrvvnnwy{njofsnylib\\IVAGRPKOLEEO]PLM\pklc\]^bkdYRJOZRRZGTRTW]TXdSVN^`XecemhVNaRO[[\cbbTkZS[lrtzb]u]err_nnfew_abjljshonWRV[\idOVOWHUXYKXpeg\NOaW[^fkg[QZ\Yddgjgiiijggiihhhggfgijpy}{{zyxvwv{uieffeffefffeedeeedebeeeebfkp{s|yymd]_bdcbaba``_]_^^]]][Z[[[XZXXXVTPPPPPONMMLMMLJHEEDDCDBCBBBBB?AA?AAAA@?AA?A?A@@>A@>@??@@?@????xqnifedgehow~zvzywwuttsrrrpppoonlnlllkklijjiihhgigghiotxzwrpnlmrwzz{|{{zwwia___^^]_^^^]]\`ab``_][Z\^__cj`_]]aadfjhkjnkjknovɾyoqqsqpnmstrrvttrtqpdYY\^`aaegegjmwwponloopqpqqqrmjighecffjhedeehfeb`ZXUTQTSTSSRSSSOMLORRQKJGDDCADBAAA@BBDEBBAAHlqqmow~~|z{~ojnvxqmwy~~}oepjtmsplfdgVKL@R\SJJKF@NOCQLgflgbVRYijXZJJQUPSXKIVZXZ[eVUQXfUbegmhVL\SMV[Yb``Tm[R\hotmWp]`om`jnehx^^fnnlsfoiWTUUafXNS[LOV[SKpfg`WJUcObbfmcUT]YWkgihfihkhhhghghghihhils|}}|zyxywuy|oeeggffefghgdeeededdedceeeekp|kcsja]`aeddcaba`__^__]]]\\Z\[ZZZWXWVSQPQPPOOMMMLMKJIEDDDDDCDCBBBABABA@@A@?B@@ABA?@@??@A?@?>???@?A?wsokddefeiv{xxwxyxuutssrqrsqqqpppoknmlkkkkjiiiiihghjmstxzyuqolmosy}||{z|yxnbba```^_^_^^_]__``_a^^[^_aciibfdcdegkijjkkklmlosǼ©xsrruspmmpqqrqtussrqf^[\_`_`cgho{}xmjpqqrqsvttttrnmjiijihiliccbbba^^]YURSSOQSSTUSRTSPLLNPPMHCABCBAABBA@CBBBBBCAHkpnopzv~~{|}nlsuwsovz|||rhjhurtoshi`lQMFKZ[MKIHEDQFCK__fqfWPVWe^YXEGPTURXIQWSYZWXVVVkV`hfng]OWVLSYW^\_To_TYfrs}t\gb`pmegoglq]amullkeneTVZYifLPWPIWUUK]jdk[QN\WTbgjmaY\_V`qfijhiikhhihhhihhgiiimv}||yyxxwvxzladghgffeefefdeeeeddfdceffcim~tfZXm{e^bdfgfdbcb```_^_^^]\\\Z[ZZZYYXVVTQQQQOPPOONMMLJGFEFDEDDBCBBCBABABAAA@ABAA@@@@A@A@@@@A@@?@?@???vrokhigghhuzyxwzyywvtttttsrrqrpqpponmmmkkjkjjjjiiihijovyzwzwspmmopx|}|z|zz{tklmfeaa``^`____]`a_]]]\]aeehebddeehikjlkjjlmklnrxǾǰwusqrrqqpoqqqrtvuvxslb^^^^``eoz|rnhimrurvvwxtqtuspmllkhhijib`abb^][\YTVSQPRRTVUSSSSSPLLMNLIDBBAA?A@?@ACBAADBBAMqpnknss|xzzhitxuprvzy}~xhgkpppktsnmj]NK?UcWOMKFDGU;>Q^\qj`PMU[ZORGCHNTTQXNYSV_]VUYRd[ahfqgaRVZMPYX^^bUqhVWdrtwc\_`ljifyqgljajoxnkkgnaUWW`i`MRWLPVNUUnekbWMU[Oaiinla]`]Xjnfjjgiihhihhihihhghkkpy|}zzyzyxw{ui`dgfhfffeefgffeeecbdfgeedgimzpbZX_o}kgjmjfedecda`__^^^^]]\^\[[[Z[XYXTSQRQQPOOONMNNKJHFFEDDDDDDDCCCBCBABCAAA@A@AAAA@AABA@@A@ABBA@AA@xpqnkljigipv|yxyzzxyvvturstssssqqqppomomllkkkkkjkkijilotv{yzzvtplkjnu||~}z{{|{{{zwwtqmkkfdcbb`_`^]\\\^`dhf_dcbeeghijkmjjklopopsʾɴtutsruqssqpprsssuttsnidb_fios}yxnmmgkrruvwwwxywwvuqoqmkjhefga_]^^^[YXURQPQOPPSSUURRRTRMKKLLIECB@@AAA@@@A@@@B?C?Trqjkpk}y|wbcpqroow|}{y~oemjojiwpftu[WRIK[bPNJHGDML;?M`eghPAHXZYMNKA>GRPPQRUY_d]OXT_b\hepjcUSaNTZY]`aTrkTUbpp}uk\YcjpgdpqfhfbrmwkjmkoTV\SfhVNVXLZSWXjkmk\ONZXQgjjtlb__[Stmhhijhhhiiiihhihhihimq|~|zzyzyxy~tg`dfgghgffeeffgedefdddfcdefhmu{hXYao|wyqiddedbcb_```^`^^]]\\\][ZYZXWTRRQQQOPPQOONOLIHFDFEEDDDDDDCCCBBCABACBA@A@A@AAAAAAB@?@AA@@AAAAvtstqpmiijns~{zy|{zyyvwuuusuutsuqrppooonmnmnllkjjjiijijmpvwwz{zxutnljluz}}||zz{{~~yx{vssvtttqpljfca__abhiefhhgbfhikjmlljlmoqqqtzǽȹrusrsutqqppqrtrstusrpjhihswususmlljikllpqswvw{|zvvtustrojiffdaa]Z[\[VUSQQQPPOOQRUUSQRTRPMJLMHA@ABAABAA@@AA?@?CC?Vrqkrnw}y}|ijqrpoovz}}y~xhlglfiwsgjddULJSf[NLNEGBQC9=DNQNNPX]`bTUYYgWfhpicZPdQRY[[_^VplXW`pp}wpiTdfnhgppfebgumulkmmgR]Wam]MRYUVZP`blkmgSIT[QZinltkc``U[vjhiiijhihhjiihjhjhiknv~}}|zyyywwzre_cgfegfgeeeeeffdeefddfdfcfgjszg\cttiaaeeecbca_``_^]]^\]][\[ZZYYVSSRPQPQPPOPONKKIHFFFDDDFDDDCDDCCCABBAA@?AAAAAAAABAAAA?@@@ABA@@@xxvwuurjimrsz|{}|{||zyxyuuuvvttutsqsqqqpponnmmnklkkiiiijijkou{{{z{wwrokkkqy{}~}{|zzxuqt{rfeefgjonpqtvwzywtmjnihhgffgjjllllknnoqoqposuíʽ|utsqtvurprsqsssssssqpnljlonkjmkjihhijjmopsvuy~{xutsstrpmjee^_`]\\ZZXUROPPOOOPRRRTTRRRRSNLLKIFC@AA@?AA@@?@@@@AB@Vqrptp||z||||pqpopqrx|{{znfmogguxmgrhffWOH[gUHKJBFFO>8>RNT]`G@FT`YKQOB>ASROLO[_cZORXh]aglgd`P^ULW^[]^Won]Wbpr{qpVfikhhrtee`ptmtnpnq^XaWkeTQZZXVMbahrnmaMN[VMaomlpld_[Slrhjihihjjhihhhhiiiihkoz}~|}z{zyyxx}sc]affgfegfegfeeeeeefffededehjo~to{}woeb_bdgedcb`a```^^^^]^]\[ZZZYXUTRRRRRQQQPOOPNIHGEFFEEEEDDDEDDDCBBCCCBBA@AAAAAAAAAA@AB?AAAAAA@Avx{yxxsklotx~{}~~~~~{zyxwwuvvtttutsusrppqpoonnmmmmmlkkjijjmopxz{{{yyxsqkihmw}|{{{zzzwpnple_a`bababcbdinsw}tligggfhgklklnmnqonrqttrsst{dzxvvrqswvutrqopttuttutqlmkkhhiikkjhefgijlopsuxz}|~xutonqssolkfaa`^]YXXWUUOQPQNNQRPPRTTRRQSRNLLMJDBAAA@@?A@???@@>@>Yqqruxw{z}}yzyxoqptwx~|uygink^tuocodhdZMH_aREJEEGGJ?;FOIVb`N@E_gWNSVI>BQQTNVXdbVTY^a[diiecVYWPX\W]^VishT[lu~{qw_`oinhqvh^`{nqvnqsnZa[`h`OWYYSM]hdnvnlVNUYQUfpgnnna^X[rthiijhhhhihggigihhihlr{~~}|{zyyywytd[_dhgeffgfffedeeffgefeecefgjn~tfdxvd^`bfffeedcba````__^]]^\]\[ZZXUTSRRRRRQRPQQONKHJFGEFFFEDDDDDBCCBBACAABBBBAAAAAAA@A@@A@AABBAB@Ay{}|xwrhnquz|{}zwxxxvvuvvutusrrqrpqoponpnmmnjmkjljhmotxx{|{{yxsqojhls}}{|{{y{xrmidc``b`ab`ba`aaedfhgcahhihhikjkmooonrrpqtssututxƻéxwxvrtvutpqsorvrsrrrrqnlmljhkjhihifefghkpptxx~}|~zxrpoptppnnifba`^ZXWVWSSPQQOOQPOOPRTRSQRSOLMNMGA@A?@@@A@?@?ABAAA^qquwzz}|~{}zwzyzonlsvz}~{wwjir\p}wmgkobi_\OXd]LBJDHIHKF?IHIYheP?BWeSNQXJ:ELPWZYWaWWWVeY\gnda\U]QS[XVc\fpnSUgu|}rvb\skoirufYeznvtmtrbb`ZmfYUYXRO[jej{npePJTUV^kojmqkb`]gtohhijjiiijjiihiihikjmu|}||{zzzzyxztc]_eegfgdfgfffegeeeeeffeefefkoob]bstd_dhkgfffcdaaaa``_^^`^]^][\YXXTTSRSRRRSQRPPQMJIGGGGFFEGEEEDCEDDBBBBBBCCBABABBBBAB@AAA@BA@AAAAB|}}|yrpmoqt|~}~~}{{ywxwxvtwuuusrqsrqqppononnoknnllmjkknsuw{z}{{zxvqogehr}~||{zxwsngda^`_ababbcbbaba```_cjihijlmlomopnqqqrqtssssvtv}Ǭzxvvvstvtuttqqrsqqqrspjkjnmjljihiiheedhjnptwy}yxssnoorsqnlkgeb]ZWTRTPRQRPQQRPPNORSRSRRSPLMMNID@C@A>@>A??>ACBA?atsuvv{|}{}}}zvvvwoppry{wnowiiyw{bfmdcibfZZf\LFICLHCHJ>EFObg]SNFQXTSLWK=DJNW]]\YQZWa_`fpk`]T]UPX^Y]b^nmUVbty}ro`]rqmiruc^pznxsl{maeZfj[SV[UNYdmdoyjjVQLRP\iomklod_[`nuliiihjijijhilhjhjhilpw~~}||{y|ywx|td]_dhfeggffefefefeeeefdbeeeeim{m^\`h{{liopkhfgfedcaba`a`^_]\^][\Z[[YVUUTSSSSQRRQQPMJIHFGGEFFEFDEEEDDDBCBDABAAAA@ABBBBAB@ABAA?A@BBAAB|~~|xsvrtu|~||xywxwwvuwuuturssqqqpqppnonnmmlmkllllosvz||||z{yvrnjihr}~|{{z{zxtniea``a`bcceccadedc``ejjiijlnppooppqopqrrtssuuutvxȱyxxwvvuvuwwvsnpqnqutspmnmopnoljhfihggggjnrtxy}~{xrqopopqroqrohca\VSSSSRRQQQPQQRQQRPSTURSRNMMNMHCAAC@??A@@?@AAA>ausvuwy|z|}{yutusopnquzu~tlxof{ygjosdjjdi_WdVGFJIO?@ONACFZmc`[XOINSXITP@FKP\``]YZd]aeenqb[VZXQU_]ZhapnYXaszqmgfgunhro`erssvnsyfd_]of[TXTUYgefhumjaQNSOQdmnnlskdYagtriiiijjiiihihhkkjjijmtz~|||{|{ywyqb^]cfffghghefeefgfffeeedefeehmuzfY_jz{zoiegffecbbbaa`_`_^^^^]][[ZWVTRSSRSRPQPRQNMIIHGGFFEFFFEEEDDEDCBAABBAAAAAAABAB@AAAAAAAAAABBBB~|{vxzx|~~}{zzzxxywvwwvutsttssqqqopoooomnnmmlnlnnpsx{yy|z|{wvtojfip~~}}zz{yzvohf`babbdffddecfgfc`ejmnfinopnnoqpqoprrsssuwvvvuvt}¾ɵ|yyyxxxuvwwuvsrooqttrpoprqptromkjjilmjjkjkrtxzz|xsomonprsrqsrkec^XURSTTRRQPRPQVWSQRRSSRSSONMNOLHABAA@@>@A?@A?@@`stvtvyzz{yxz~~xusqmrrrqruyr{kpiitzzrhuznjjddk\SXVLKKKMBBKEDEMde]b_bQLLJVQRSBCHN\ccZ_d[aX_mrg]XVYRX_]Zccnl_W]syvlglenpnuj`cxo{upwqdfTjh_VYZW^ebaclsjeWSMSO\illlpuh^]glyojihjijjiijhjjiiihjjnv{~}}}|}{vvzqc]^cgfggggfieeegggeefeeeeeecglr~~}|kbl|}pgddfffdedaaa````^^^]]]][\XWUSTTUSSRSRRRQOLJJHHGHFFGGEEEFDDDECDBBABBAAAAA@AAAABBBAAAAABBACBA~{{{x}~|{{{zxyyxxwwwvutssrtsqqpponoonnonmnlnmomqux{|{|z|zzxtqjihoy|{{zzywrjeaa_abcceccbddifbelnpkkmpnoopprrrsrrrtuvuuuvsutuyõɽȸ|yxwxwwvvwwvuvtqmmuvtqqsrqsurrnkmlnqpmmnnntuuw|~{xuroppqqssrsskgdaYYTSSTQRSSQPTXYUSRPSSSTTQMQOQOICAAA?@??>?@?@??`ttutw{yz|{xz~ytqqmrrstxty~p{tjiiqzuvipztlfji_g`QRYRONVOGPQOJFUb\YjhiVUUQWSKRD?FO`i\]f]fgWhtlZZZ[UW]^Zc_nhb\[iwulmrkhupko_j{q|tuskhXhoeTYXY]ffW^grpeXWQRN\aknlgqnb]fiyxlhkihhjhigijjjijihilqw}~~}}{|||yxxpc][agfhgffffeefegfgfgfeffeefhkpzx}pkyjd`affggedddaab``_^^]_^\\][WWTTTTSRSSRRRSQMKLIIHIGFGGEEDEDDDEDCCCBCBBCBBAAAAAA@AB@AABAABBBAAB~}~}|{{z{zzyyzxwvvvuuutsrqrrqqoppponnnlnlnmontuy||||{{zyyvtlgflz}}~|{|z{vqiec`_bbdedefdgghechopmklnoooopqrqsssqvtvvwvutrqquv¾Ⱥʼ{{ywxxvwxuxyvvurprtvstrrttsutrqppprosqprpnqvxxz}zvurrstrprqrqoihfbZXUSTTSSRRRSWYXVSQOSSSTRPLPPRNPJAAA?A>??>@?A?>^vttwvxy{zywx{wrmsrspttvszvpymkhm~upumyzlmkki[gcOU_SXZYRVfVMLLVaQajmb]a`R^ZMPI@EIde^cb^x^^roXZZ[WU\_[b`jhdd`exvlnunmwhnn\wyvyttqk_bneYU[^adf[\`rqk\W\QMUdfrkqfsf``jq{rjgjkhhhihijihiiihjkmu{~||~}zyznb]\_ggghgghgfffeffefggfeeeefgkpyjabwp__acgjhfeddcbbaab`_`]_]]^\ZYVTVTUSURRSRRRPNLIJHHGFFGGGFGGFDFFEDCBCBADABBBAAABAABABAAAA@BABBBB~}||||zx{zyxzxwvvvtusttsrsrrqppqoonnmnnnonnqtwz}~}{||{ywxunigkw~|z}z|{xtkfbbabcdeffebgiechnpplknnppooqrrrrvutttuutrstrqruuyŷʾ}ywwyyxwvwvvwwvursswussuruuttssuuqmqssstutrsuuvz|vustrsrrpsssohghd^XXTUUTRRTPRX[XWTQSRSSUSRNORRPPMD@@?@@A???B@A>[wsuuux||zyx{|vsnrvxrtwxu|uwwjjgwtkyxqxnjpsmd]cZU]ZV[dZVbfVOML]^Vfli`jhZT\cYPLIFMZ`_bZrj[mraZ][YWY]^\akfhdfesumnunnnnvlc~wyyttpfbmh[Y[cjefbXcnurcW_[RQaelpnrgsedapuxlhhijiihiiiiihhijijlov|~}}}|~|xx}oc^]_ffhghgghhhfegheggfeffeddflotf_]cur_bgkkiigfffdccab`a``_^]]]\ZVWVUVVUSTSSTTSOLKIIIIHGHHHHGFGEEEFDCBABADBBAABB@AAAAABACBACABAABAA~~|}||{{{zzyzzyxvvwustttsrrqqrpqoppmmnnmpqpqqtx{}}}~||{z|xuqjgmu~}||{{{wsjdaadbceffgfeihddlqqmjlnppoopopprsvsttusvvsrqrqttuwȽʿ{yxxvyxwvvxuvwxuuutvvtsvvvtstssvuqooosvvxvvxztvz|wuvusqrqprsrnieheaYYWVUUTUUTV\_ZWUTSPRTSSQMOQRRSQLDBA@?@A@?@A@=Utuuswy{zz|{}~{tsrsturux{x~~u{tleqviu~xtummymkd^[a\\ZZ_d\WeaVUX`fW_hb_cra[UUdb]TILVZ]c`fp_eqfY][]W\[b[bkgigkkpzstm{ukextgj{uvwpricje\YcglahiU]kxsi]`_UNZekrmpmishecqxshhjkkkjjjihjjjkikikmpx~}}~|~|yz~nc^]]dghhhggegfgefgeffffgedhfgjnz}zuf[_en~xmnrniihhgfedcbbbaaa_`^^]]^[WWVVUVTSTSRTSQNMLJJHJHGHGHGFIGGEFDEDDCDBACCACABBBABBBBCBBCBB@BBCBB~}|{}{{zz{yxxxxwvwwvttssssqpqpopppmonmonoppqvx|~~|{}}{|{xvqkhhu}}~|z{|{ukeb`bdefhggfiffchnrrkkmnqnoooportuurtstttttsssststvyŲ{xxyyywyxwxwwvvuuuvuuvuvtuvtstrttmllkoruzxxuwvuy~{xsrsuuqpoqrssjhhgd^ZXWWVUWWWW^]YVVTSQRRSSRMLNQSQQMIAA@@A>@AABB>Vruttwz|}|}|}~{trrrpwxwyzx}{z}qdfonqxyruiqykia]_``_e_\YY[_YRZ`dYUi`^bkp^`WT^fnhZUOY^adnfamm[`\_[X\d_aljiglqownlr|ylnwreoztxtqn]im\Y`gpffhaU`ntkb_[^OOhitrljbophejttnikljkkkkikjjiijkkjkqtz~}|{wznc_]\cfhhhheggfffegfffegdeefegjmuzytssqe]drzrigghhgfeddcbaaaa``_]^]]YXWWTVUUUTUSTSQOLLJIJIHIIHIHHGHGEEEFEDDBCDBCBABACABBBBBBABBCCACBACC~~}}}|{z{{zzxzyxwwwvvtsurtrrqrqppppomnmompoopsvx|}}~}{{|{yvqigir|~~|{}|}{wjfbabceghhfghhbilstpmkllmoopprqrrtttssststtutvusussv~ƿ{zxyzxwwxwvtvwwtvvwvvwvvtuvuvrrtqkjjijqvz{{yutuw~|vqttrqollnpsqgjhjhb[YZXYZVVWYa^XVTQRSTSSSQMNQRUTPOMFAA@ACB@@BC>Sqvrtwz|}}}~y{zrqprouzy|{y~{}wgbisp}s}xopipshdY^ac^anaXSTUXNXfz[U_dVWfk^ek^SVevmsi^^adipcjm\a^`^XYdZ]kmfgkoppntt|uotxqfuyv|rl_hsa[`grsdjbW[irpd^[^VL`glqpmi`pojbjwmjikkjkkjkkjkjkhjkjjkpv}~}}{x|ke_]\fhhhgffifhfgffeedggdefedgimqz{usqqqrlku}pgbafiiheedbcbabba`__^]]]YWWVVWUUUUTSSRPMLJJJIJIHIIIGGHFFEECDDDCDBDDD@ABBAAB@BBCBBAAB@CCCADC}}}|}||{{{yyyyvxvxvvwvrusssrqqqppooonqpqqqrvx{~}}}}}~ywsmihs~}}||{||ulfcbccefhhiihffmqvsrnnpnnoqqqqstsrtssuuvuvvvsttvvuvxzŶç~yyyyxwxxwxwwwxxwxwwwwwvwuwwuvussnhikkgmtxzyzvvuvx~{vsprsqljkortqklllga]\ZZZZXZ[]c\ZWTRRORSSTSOOQSUSQONKA@ACBC@AACAQpsqtzy{|||{|~|sqnnnquz{y~yzwbdosoyu~oimnln`R[aYZfk]\XSSRX_sf[[b[QaogZhja]Zdmwyrh\^dpgfi][che_^e^]mngjlqsmo{u|vzswnkvty}ndjugYknsrif_]]cnogd^]^[Rriroppf^qnjdytliiljkjklklkikjihhklnpy}~~}{y|kc_]]behgghhhgghgeeefegfeeeecfhmrz~{z{{||mm~xldaadhjihgfeecccca`a``^^^\YXVVVVVVVUTTTQNMMLKKJJIIIIIIIIHHGGEDECDCDDBDBBBBAABCAABBCCAAABCDCDD~~}}~z|}|zzyyywyxyxxtwuutsttsqrqrqpoppoqqqstwy|~}~~|}{}zvnihs~}~}}}{ulfebffghkhkigeiqvxsrpooqqporroqrosprvsvwwvuusttwwxwwv|óè|yyzywxxyxvxxxwwuvxwvvvwwxwxxvvtrojjlljmpv{ywuuvux|}xtsrpqpkllqoqpmmmoga\Z\^Z[YYZ]e]ZYTUSRPSVWTQPQVUTQPPQEBA@A@A@@@>Psvwwyyz}}|}}}vtroqty~y}~p^nmrmq{nknjpm[U]a`\od_fgQRR]d_[^U`V]gp[Xedd`immtsnjeenlfdb]amnf]gc\pmjnmqvlvystzwuukowyzyljn``ovntoe`eh^rqkbcdafZalovpnkecsiqlwnijjjjikkkljjkkkjjkklmtz{xz}jd_^[bghghhhhgihfffggfgedhefffhlryj`dv|yvtrf`bejjkihhgfeeccccc`b```_\ZYWXWUWWWVUVSSPNMKLKIKIIIIIGHHHGFEDFEGECBDEDDDBBBBBACBCBBBCCDCCBCCD~~~~|~|{{{{yzyxyxxwvwxuusttsrqrroppqpqqppprvvzz~~~||~~}{{vqhis~}}|}}tjcbcfefkkhklgiptuvvurppprqqpooqposttttuvuvvvsstvx{xxv|òĩ{{zxwwyxxxywxyywxwywxvvwwvxxuvusqmhnkikmqqyxzywtvv||ytrrqqnnlopnmooojjidc^_^[^[\\_f]\WWTSRSTVVSQQRVWUQOOQIB@@@?A@@A?Hlvwyy}|}}||yuvnntw|||zchpspuu}tlkook[Vb`ZhlWbhbSR\ld]\Y_a]kgh_b_ciclmy~ohhilkididkhsk`ee`rktmoouhrrox|{zviq|yylcf`go}mswedgsZkxlffmiedVdjtzqjldiojtlmhjjkikkjjjkjjjikkkjkkpw|zz{~hb^\Z`fhhgihhgggghgfhhhgfgfffffkpvj`^foutspoheionkkjhgggfedddba`ba`_^\YYYXWWWWVUVUSPMMLLKKJKJJJJIGIJIFGDGGDDCCBDACCCBBCABBABBCBBBCCCDADDB~|~|{}|{zyyywyxyvwvvvutsussqppqpqpppqrqqtuwy|~}~}~~||{xwrjgp~~}~~}tjeeeehijjjmjglsvwvwtspqqrtppopprtsuxtvtutvuutuxwyyxvvw{é{yyyywwvwwyvxxxwyvwvwuvwxxxxxwtuojjnkhhnnqtyzxvwvy}}xtqqrqomlnolklmnhhgfb`___^^^`di_ZXWUVUSSUTQPSSVWWQOOPOC>??@?>>@=?huwwx}|~||~xuwmqvxvw{y}z]nl{wwzsqqlobW^]WXl`[^fXNUhl^Sb[`Wkfjccbblknnrzngemmmp`likgridaeammyoomslqsu}y{ohz{unda\qsxxlzo_ktc`{ojfrka`Xbhmt|mehbloqqjlhjilikkjjikjkkkkjikklpy~~~zy~|ja][Z_fggfghhhhihhfgggfefdgffffko~}j_afowwvuwvrqyukghjhhggfeedcbb`a_``][YYYXXWWVUVUVTONLLKLKJKJJKHHHIGFEFDFEEDDBDCDCDDCABABBCABCABBCCECBBCD~~~}}||z{zzyzzyyyxyxxvvuuusvtrsqqqroqqqqruvxy}}~}~~}z|uljr}~~~|rkfdcgiijkmjjkqvxwvuvurpqqsoppoprtvuuwwwuutwuuxxxyxxxwuxĬzxzxzywwywyxxwyzzxyxxvvwxxxxwvxwtljonokkorswyyyuwy~ytsorqnnmmnmmlkkkffhfda`_aabafiaZ[WWTTUSUUSRUWYXURPPQRLA>>=?>?AA=`tvwy}||~zvwnpzzytvy|u`sry{x{ywxwvf[\ZSan[\^`SRYipXZ`WYfclb_ddcrjnt|sfblpkrfmmffxlg`cejpwsoososuw|ukkxkddfnwwvvqsalye[q}nenrg`^Yltm}xikjgtmqkikjkkljiikijkmkilkjiikouz~}zyzj_\XY\cihgfgggghgegfggffedeefefjnxzh`is~ynedhjhhggedddcdbaa```\ZZYXYXYXWVWVVSPMOLLLLKKKKKKHIIGHHFEFFFECCDDDDCCBBBCCBCBABCCBCCBBDDDC~~}~||{{z{y{yyxxxxwwvutuvtvssqqqrrpqrqruww||~}~~~|~zvoio~~}|{rjfffijmmmmkhpvyxtvxwtqnopqrpqopssuvwwuwvwwvuwwxxxxxxwvw{Ĭ~{z{yzzwzyxxywzxyxzyvzywwyxxwwxyxurmnooijlpruyyzyuyzsrrpomlnllklklmkjjkjjdbab`deih^\]ZXWTVWWVSTWYYYVQQPQRQLGGGGGGGGC[vvvy~|}}}{~yy{pqz{ytu|~mi|uq~u}~zw}f\ZUTna[\_ZVU^ydVcaZd]dn__`^griq|~kfipkqijqefzmi`^eis}wnqqrory|t~nhthfklswxwrvral|iYfyzhnvtac[hvysnhpejvlvllljjjljikklkkkkklkkiijow}|y}~sg\YYW\dfhgggggghhghfgffgffeehffinv~~|omyxieaegkihhggeeddbaba``^\[YYXYXWVXXWUUROLMLLLLKJJKKHIHHHFFFDGDEFDEEEDECCCCBABACACBBBCCCBDCDDC~~}~~|||{zzzxyzzywxywvvvvustsrprsrrqsrvtvy}~|~}||wpjm}~yrihfgiijknlhlvzzutuvvtnloprqpqopstvwvuwxwzwutwwxxwwxvwvvyȽŰ}xyyyzyyyxzyxzyzxy{yzzxyxzyyyyywtqqomnkkkpstuz{zv{~ztssqnmmkikkijommlmlnlkkbccgfgg`_^ZXVUUXYYUUWZZWUPQRRQSSSQSTRRTPN\uywx{{|~~|{~}yvzopz{zvx}~rxvvuwq|f[]VWcZ_``W[]woX[fb^`fkg]d`\ommvwringjrgjuigxqmc`bis}wpnnoptxv|~omhivnrwx}oyn^wmbfvuwvryf`gdkvy{imnhqtlujjkmlkjkkkjkjkklllkmmlmrz~~|yysoi^WSXWZchiihhghfhegfggfgggggfhffilqymnxh`adhkkiihgfeeddcba`aa^[\ZYZYZYYWWVWTRONNMMMKKKKJIIGGHHFGFFEFEDDDDCDEDCCCBDBBCCCBCCCADCCCDDC~}|}|{{z|zz{yyvwyxxvvwvvuturqqurrqrssuuxx{~|}}|{ypjo|{rhihhjjlmlkhsz{wssvxutnmopsrqpoprwxwvwyxwvvwwxxxwxxxvuvvx{´½ĺ|{zyzzyywyxyzyx{zyxyzwy{yyzyyvwytspnopllmnros{{xw|~}tqtooonlnlkjkllloompqmkgcbdeiib^][WWUVZ[[ZWZ[WYURPRQRSSWXX\Y[ZXX_rvvxz{|{~~{{xv{qt{}|z{}sor}nz||xi]]WW]a]^[Yafr]_gg]bmkfgdi`dpkwrqsmfqrhmtklusub\ghvxwpponwvsxxttjrvluw}vpsdtzghrzzrtxgfjhnzt}erjmuppunjllkjjikmkllkjkljmlmlou|~~}z|siecZPRWYZbghhhgigggfffgggffeefgfefgmpwjbhzte_dimkkihhhgefdcccb`_`\[ZYZZYYXXVXWXSONONKMMLLLKJKIHHGHGGEGFEDDDDEDDDDDDCDACBBCCBDCBCEDCDDDD|~}~|}{|z{{yyxxxwxwwwvwvvurttqssqsqrtsvv{}}{|{yslp||qjiihkmpnnkmx||uttvutrnmoptsrrqrtuwwwxxwwyxxxzxyzzzzywvwwyʽȶ¹ú~zzywyyxyy{zxzxyyzyy{zzzzwwxxxzxxvsqrssljnpoqu{xy|zwtqoqrqploopnlpnoprqrkkhdbdghjd_^]WWX[[[][[[]\XVQRRRRSRV]``__a]]arxywy||z{~{}zzv}us{~y|~zowwszyzvg_[`\[_X`Wbfld]djbdoxZeskebip|jh{qcrujo{qlsoxhaiju|{trrqxxvvswzrunlvxvqtlpqjmwztxoloimwxvpiqmpvqyrklkllkllklkjlmlmkknnmmqv}~{||pifg`QPWXY`fihjhihfhgfghghgfegffgfdfkpujbajzxhfknomljjigfdeddccaa`_][[ZYYYXXYXYWVTPONMLNLLLKJKKIIIGIGFFFFFEEEEFEFEEDDDCDCCCCDCCDCDDEEDDDD~}}}|{{{zyyyyzxwyxxvvwuvuuussrqqtspruvyz~~~}||zvlmz~yokhhhlmnnlmszyvutttttsppoortsrstuwwwwxzywx{xxxxyxzzywxxxxx{̼´ľŶ}z{zy{{zzyzzzxxyz{zxzwzyyzyzxwxxwxvpsttmlnlmo{|{{|}xunpoqtrrrtrnooomrssrolhefedgle`^][ZZZ^`^\^[]^ZVTSSQQPRT\bbd`_^_apxvyzz{yz|{|{|w~tuy}t|p~~v||so\d_UVU\][jhk^bm_gh|japqiafpujjzwjptoruvnqktlbgktzspqqxuxx~t}zwqluy{ypoosxojv}yvuqoqiw|yeorkvvqusnmkklkkkklkkknljjlmmlnt{~|||smkkeXSUWW\effhggghiffgigfggffeedfffin{l``ht{qnponmkkihfgeecddcbaa]\ZZYZYXYXWWXXVRONONMLLLMLJKKIJHGGHHGGFFGFEFFEEDDEECDBBCBCDDCDDCCDDBDDE~~}~}}|||{{y{zxxxxwxvwvuvuttqrssrtsrttwwz}~}~~}{umnxxqlhkklponlpx{zttsusssrpoqqpstsstvyxwyxzwyxxyyxxyzzzyyxxxxy|Ǵǥ}}zyzzzxzzxyyyyyyyyxzx{wxzyvvwvxywxtuvtrnjlmu~{yz|~}zuurrqssrsqsqqqpqnprnpomififafjeaa][[\]dc_^]^`_ZVTTRRRQQSY_bb_`a_^nuxxx|{y{{{{|}x}xwy~~~z{tuzsy{wyp]i\PR\ea_hg^`jbemxnhyoljjkojfqvqrqlxvtwpqqqcekwytoprtpw}yzxqm|y}vluuz~usz{|~z|wtzynzh{vgztursqikljlklnklkmnnmknlmlpu|{~}urpog]VVVX[dgghghiggfhdfeffggffffdeehny}zyi`iw{uqrmlmkjhgefcedeaaa`^[ZYYZZYXYWXXVUQONNMMMLLJKJJJJHHHHGGEEGGEEEFEFFDECDDCBBCCCBCDCDDDDEFDED~~}~~}}zz{y{zyzywwwxwwvwvtustusuttwuwy}~~}~~}}{womwxqmilmortoouzywtwwtttttpptstsvuvuvvvxxyxxzz{zwx{wxyxyzyxv}{{{ͧ}{z{zxwzy{zx|z{zxzx{zyyxyzxwwwyyxvwwtvsspmlp~yxzy|~{xqrsrqsrsprpstssrqpmpnighffcdkfbb^]`acebbb_aa^\VSSTRSQRTU]baa_a``gtw{{{|{}|}}}~y}|zs{||{wt}q|zus`d\RYZZ`ekd[fgajwphshomrkgglqwwpn{|t~vrstreoy}wqrsttx{yoqvzwtzy|}zx|v}|{z{v~nrtszrxywsjkmklklmlklllmmlnkmnow~~|}|vtrrnbXWVVYagihgighhfghhghfgffgeegeeint~~}}{{sp|y|~vqppnmkkghgeeedbdab`]\[ZZZZZZZXXXXTQQOOONNMLLMLKKJIFHGGFHGGGGGFDFDGEEFEDECDCBBDCDFCDFDEEEFE~~~|}}{|zzyz{zzyxyxwwvwvuttuustvwwy{}~}|zyrovxqolmpqtvvxvyzzxxxvtttussusutssvvvxxwwyyzzzzzyz{ywwyxywxxxyyt{ͽȝ}}{|z{zyxy{{{zyz{wzxyxywyxwxwwyywwwuttttqqovywwvz{|yvsrrsqrustuuyuttrqopolihgebblgcca_aecca`^_aaa]ZVUTSRRRSSV]`__``_aqvy{{{{||}}~x}sgo}~wz}tr{~~{{{vs_ccXb][emue`ggcqoisjlojmjjqx{rky|w|zuutvintzysxuv}{~sm}xzww}v|}~~x}|{xlwvzszw{mkjkkklkkmllmkkmlllmmrz~~|{vuttmc[XWWW]ffihiefggfghhgggefffefgginrrim~vspqnmkjihgffddddbb`]\[[[[Y[YZYZYWSQQNONMNNLLLJKIIJJKIGGIFHHEEFEDFEEEDCDDBBBCECDDDFEDFEFEFF}|}||}|{{|{{||yyxyyxwvwvvututtvvx{|}~}~|}xrnv~zronorsux}}{zxzwxuvtssttvvxwvyyxwxwxx{{{{zwwxwxxwwxxxvuutupwý|{z|zzxxy|y{yzy{zyz{xyxxxxwwwxxyzxutsstrst{~wtuuwz}yvtqtqquwtuwtwvwuusqrrmkhgcbbifddbabc`_a`^_bbc]WWTTSPTQPPSYc```a__nxz{|{{{}}~z~okssvyv~wty||x}{usnfb`g\[f{u^binmqk||mljinlioywviy|~vsyxwnqtu~trzwx~zx|y{zsx|x~}~zm~x}v|w}lkklkkmklmklmkmllnmmnv}|~zwutuoe\YVYW]giihjhfghghhggggfgggggggimr|lcbmwrrponklkjhhgedcdbb_][[Z\ZYZZZYYYVRQPOOONNLLLKKLKKKJHHHHHHGHGEDFEFDFCEDEDDDDEDEFEFCFEEFGFFG~~~~}}}}}~~}|{{{zzyyyxxuvwvvtuuuuuuwx{}~~zzsnu~~xrpoqstvy}~{zzyxuvttttuvuyzxyvxwyyyyz{z{zywxywxxywvxxutuusrvüȵ~~{z{zx|yz{y{xyy{{yzxxwzxxyxwwyxyxwrrporqrx|wtssuy|yusqrstuwvuwyxvvxuvsopmlhebbbiieeccdaa^ba_`_^_[VWSSSRSSORSU]``b``_hw|}|{{||}}||joxms}ywzu~|{wwphghea`oybheldsm~uwnfnjkp~v{j{{yrywwqntwqqyy|~~v{wxzx{{vqy{y|}tlkkkkkklklmmkmknlnllpx~~zywvuunfZWTUX\fhighhggggggghgghgggffgfglp{ka_fsxsspnnljiihgfeedcab^]\ZZ[ZZYZZZZYURQPPPONNNLLMKMKIKJHIIGJIGGFGEFDGGEFDEEDDDDDCDFEEDDEEGDEHF}~~~~~|}}}}{}}zzyzx{zwwywwwvvuwvz||}{vor}zursqsuwz|~zzwtuustsutvwwvywzxyyyzx}{{{{{yyxyxwxwwuwwvtutvx{˭~}{y|zx{zzyzzy{yyyxyy{xyxyz{xxyyxxrrqpoqns||xvsurux|yusqrotsvuuuvxwywvsstokjhfb`ajjedecaabb`abcb_`[XUSUSQPPPPOS[`aaa_^cw}~{{|}|z|zyipvjp|}}y{u~~yx~{ommhndfngilhcooy~z~tjhjfpzw~px}|syyzuks|my}}yxt{t}xvyz||okmlkkkklllmknmlllklmtz}{zxvvuof]YVWXZeiihghhggfgiihihfghfeffefjp~}{tc^doyusppomkjihffeeedca^]\\\[[YZYYZ[XUQPPPOOOONNLMLKLLKJJHHHGHHHGHHFEEFGFHFEEDEDDCEEDCDDEEFFFEG~~}~~~|{z}|{z{|zyxvxyzz{yywz|~}xoq{{vtrtuwy|}|zwwtvsvtwtyzxx{wyxx{xz{}}z|yzwxyz{zwvyxvvxwwyyzĢ~{y|{zz{|y|yy{yzzyyzz{xyxxyxyyyzxrrsroopw{xxuvstsz{vtrqprrtwvwyvxutusmqroniec`a_hihebb`abcedddbbb\YXTVSTRPRQPQX_````a`o{}|}|yz}{~|}ztjttlp{x{{}zz{|}x~qpmqrijsgtsjnyvv}z{lkgu{|}vz|zuu{vpv~}r~|{|}}~v~{xz|||ulklklllllklmnlmlllmlpv||~~wwvwupi\WUUWXdihiihhhghhgghfeehheefdcejpw~}zzuferztsqqnlljiiifgdddca][\\[[[ZZZ[ZYXTQRPOOONNNMNMKMLLJJIIGHHGGHGIFGGFGGFEDEFDFDDECEEEEEFFEFEGG~~}}~}}}~}{|}}z|||~~{||~}ympy~zwutvv{||~~}|{{xxwuuvtw{{yyyy{zz{zz|||zyzyxzzz{zyyxyxxwwxzz|ȹ||z{yzz|{zyy{zzz{yy{z{yxxyxyyxyyvrutqrrt||svvtttw{||yvtpoqnquywwyvxvwslmpljfdca___hgfecbaccfghgfedd`[YWUUURRRQRST\_^b_`biw}}|{z~{~z}{uksvkp~{}{}|{{xvwvyujxlnxur{{v|{}tihxy|v}zzyt~vw{{ty}}{|~zy~w}}|zvqlkklmmlmmmmkmlmnmllnsz~~}yxvvtpj]XVUWYbhhhhihihiiggghefgfgffeeeinv~~}}twxnpzrrppomllihggeedda`]]\[\ZZ\[\Z[YVSSQPPOONONMLNMMKLKKJIFIHGHIFHEHHFFHEGGEEECDDDEEDEEDDEEFFGH~}~~~~}}{}|}~}}~~~yonw|yvwwwy|~~{yxvvwuvvyzy{xv{zyyz{{|z{{yzzxz{{{yxwxyzxyxxxwyȹ}|{{zyyzyyzzzzywzyyyzzyxwwyyyyxywtttsss|{vwwtsvyz}zvttpnpnqsuwwvwxttpnliifdbba_^^fgcdc`_cceeghhhjfb]ZXSSRTRQQQSUYbcedaadt|}~zyy{y{z}z{mvtmq~||x~~{z{}wrtuqxtqy{y~~zujgy{zx}v{v|yy|zvz}{~}}y|pmmkkllkmnkkmlmlmmmlmot{||{zvvvtog]WWVWVahhghihhgfhhfhhfgggfffedegmtzmaYc}|ysqqpomjjjiiggfdeb_\[\\ZZZ\[Z[YYUSQQPPOPOONOMLMKLKKKIJHHHGGFGHGHGIHGFFDFEDEDEEECDDEDDFDFFGH}~}~~~|}|}|~|rmv~yyuwy}}~~~zzzxyvwyy{{{xyyz|{{{{z{{zyz|yy{zzzyyyzxzxxz{yz}ǽ~~||{{z{z||y{zzxzyzzyyzxyxzyvyxxvwttuqu{|vwxwvwy}}wsrqqpmnqsuvxxywvqlikhfba``^\_fhffd^]^befhikmlge_ZZXTSSSQPPRSU_gheffdn|z~|~xz}}{}z~tqqjn~xy~{}x}}wxxq|v}|ztgm{~xv{zy{yxyyyx}|z}~u}|zmlmjmkmmmlllmlonmmlmnrv~{|wxvusme\WWUVV`gihiihihhhghfhgfefefgedfhlqoc]WWcy{xsqtqomkljhigefeda]]]\\[][[[Y[[WTRQRPQOOOOMNNMMMLKKIJIIHIGHHIHIIHIGFFEGEEDDEEFEDDDEFGEFFGFH~~}}sow~|{zyy{|y{zwwz{zz{}zzzzy||z{|}|{z{x|{yz}|xxxxyzyyzyxxyǾ~|{|z{xy{zyzz|{zyzyzyzyvzzyzzyy{xywttww|zzyzzw{{~|yrrpnoklqsvvuvvurolljigcca__[]giedb^]`a`cikkplge^ZZXTSTRRRRSRS\jmkjkkny{~|~{wz|}}z}{nnllu~|}{~~{{~txzx|pgr~zu{z}~xz{{z}w|}{qllmklnknnlnmnnnnnmnnoqx~|zyxwvsmg[WUVTV]fhhhhhhihhihfgfeefeeeeeehmqtf^WX[`mzwsqrqomkkkjgfgfeb`]]]]][[[\ZZYYVTRRQQPOPPOONLMMKLKJJIJGIHGHHHIHHGHHGFGFEDGFEEGFEDEDFFEHEFGG~|snt}~~{{z{}~yzywz{{{|}{|{yyzz{z{}||~{wzzzx|xzyyy|zxyzxyywyǽ~}|{zzyz{{{z|zz}zzyyzxwwz{yzy{xzwzvvyv~}{y|zzxzy}{vprpqmmnprsurvwtrolmkifcc`_`[\ejgc`]^_``dhkimlhf`\]YXVRSRTRQRRXgsrpqqqvz|z{uy|}|y{tllnz~}~~y}{|y~rku}{t}~|v{~}}~{xummmkkjkkmnnmmlnnnonnns{~}|zywuutnc[XVUUV]fgiihhhfgghihgdgfedfgfcdejp|fXXY^gs}{uqrqnmmkjiihefeb_^]\]][[\ZZ[[XWSRRRQQPOOOMMMLLKLLKJJIHGIHHIHHHHHGGGGGFFFFFFEEEDDEDGEEFGGGGxmrz|~{~}~{zyyy{|{|}{{z{zy{{|{{|{{z{{{xzzwzzxzzyxzyyyxyŸ~||zzy{z{|{y{z{z{zx{xyyx{zz{zzzywwyw{}|{yy{yz{~}zwqoqqompmnrortssoolljifecba__`glhc_]\^``cggikiifa^\ZWVUTTSSSSSUcw}zy~}yzuw||}yyxgjn{~~zv~ww|||sn~~}x}u|}|}vronljkmklnnnllmmononmou}}}yxxvwtnc[VWVVWYdhgghghhhegghfggfeeeeeddfhmy{gY^iq}}vpqrnnmkkiihgffa_^]^]]\\][\[ZWTTRRQPPPOOOOMNNMLLKKKJIGGGJIFHIGGIHHIGGGGGGEGEDEEFEEFGGHGGHHynqz~}~|~z{yxxx||~|{zyzyz{||}|}zz{zyyyxyxzyzywxxyxyyz»Ķ|{{||y|zy|yzyxz{{zy{zyyv{x{{zyzywvzx~{||||{||{}|ysooopkhlmknonqpmlmpmjigca`aa_^inie`^\]^_`dgkjhgfb\]YWVTRSSSTSSR[tw|{vyxy{||zy}vhjl|w~~~|}v{{}|z~yuq|{{~{{}}|xxokklmlnmlonmnmlnnlmomory}}z~zxyxxwvpcYUVUVTXbghiifggjgihhgfhfffffeccejpxrhqzv}uprqomnkkihhgffb_^]^^]]]\\]\ZXUSRRRQQQOOONNNMMMLMKKJIHIIHGFEHIGIHHIHHGHFFFGEDEFEGGGGGHHHII{squ~}||zwxz||||{z{|{z|||}||}zzzzyxxwxz{{yxwyxywvxƸ|ywxyx|{yzzzzyzy{|{yyzxzzzz{{{xyyzx~||}}~}{{|{~}wsqqmmhehjhnnrppoompoligdc`aaa`gnhc`\[\]_`cfijjgc_^[ZXUSTSSUVVTTSf{|wyyy{|}{{zmjsy{}w|~|vt~y~|z~{~tqmkkkmlklmnnmnonomnmonpu{~{|z{|yz{zshYVWUVUV`hhiifhkijijhfggfffeffcdegpvwliy|vorrpommkiiihgf`_``_^]^\\\\]YXURSRRQPQPOOMNNLLNLLMKJIHIHHGHGGIJIJIGGHGIHFHFEDEGIFGHHHGIIIItpu{~~|yyzzz{}|{{{{{{||}|||zyzyywxuwyy{{{yyyxxyvzyÿŻ~{{|z{{{{{x{yzzzy|zyxyx{yzzzzyzz{y{~}}~}{{z}||vopplifgfgklooopmnpromkifeca_`^flgb^][[]`bcfggkfa^^[YWTTTVTVZYVTT[v{}wwz{|z|||ylkv}{x|x~}~yqmnkmmlmkmlllonmnnnmnonoqw~}z|yhYWYUVQU^ghhhhijhgiigfgfhfffefddggmtsiehx|wqpqpnnllkjihhc`^^__^]^^][]\ZWUTRRRRQRONNOOMLNLMJKKKKIIIGHGIFHIIKHHJIGGFGGHFEFEFHIIHIIHIJJ~trrv|zy{}||~|{{{}|{|{|}}|{z{zwwuxxzz{{ywzxwuwxxǴ~||||{||z{yzz{z{|xyy{|{zyyxzyzzyyz}}}}|||}{|xrpmljhdegiknplpnsposnmggddb^^]^ekeb_\_^^`abbdfhb_]]ZXVXUSWXY[YWVTRbuyyxyzy~zw{~~{|z{}vlow~y~{}}~~{ztplkkmnmmlmmomlnnnnnmnnnrz~}z~|iZWWXUUV^higgjiiiihihhhggghegeeefglqsfaem}{vsprqonmkkjhhfb`_____^^_\]]]YUUSRRRQQOPNNNNMMLLLLMJJIIIIIIGHGIIIIJHHGGGGGFFHHIGHHGFGIHIJIIzqqw}{|{{||||}z{y|{||}||x{yzxvwxwzxzyzyxyzyyxxwzƪ}||||~{z{y|||y{{yzyxzy{|zyy{{zzzy|}|}||{}}{|||wonnkhfffeinqnnmprqppliedeb_][\[ajd_]]\]^_`__egd`^]\[XWWWUXZ][ZWVSTVfpopnps{~y}|z~}y{wjrw||{}}z}xxvsonmlmmlkllmmnmnnnnnnoonpuz~{z{hZWWUTST\dhgjgijihighfghhhfgfedffgkqznaem{~yxurpppnllkkhhea^_`___^]]\\\\XUUTRRQQPPQPOONMLLLMJLKJIIIIHIIHGGHJHJHGFHFGFGHGFGFGGGHIHIHIJJztquz~}}|}||z{zz}~}~|}{{zzzvvyyzyy{zyyxxxy{z|x|Ÿ~}{|y{||{{{~~{{zyx{z{zzyyx|{{{y{~}}~}}}|{y{~|wpnlhggffeiprqrqqsurnifdba]^\[Z[`id^\[\\]_^`_ceca_^^]YXXYY\]]\[ZWUTR]ikklmpz~{{{|~}y{}yls{~~xstqqnnmmmolmmnmooonononooosy~||ygZY^]][[`ghjjhihhiihghhgfhfhffeefhjo{}}{ogn{~zwvsrqonlmjkhhe`_````^^]]_`][XVUTRSPPPOOPPNOMMMLLLKKJKIIIIHHGHIIJHIGHFIGIHGGHIHGHGIHHHIJJJK~|sqrx~z|}||yz|{}~~~|}}z{{yyyuxvwyzzyxxzz{yxxzx|ʸ~~}|~{|}z|{}z{|{~{{z{zyz{{|z{xzz}}}|z||||z}}}~{vrmihiihhgknprtttuuqkfcaa][]Z\Z[_hc]\ZZY[\\\Z^c`bb`^[[ZXXZ]_a_[ZWUVUU`jljlku}|}{|||}{{zou||rnnpmmnnnnnnnomnnnopnnnnpru~~|{vddqyzzywuofgikijghihghihgggggeffeejpx~y}|yxvqrqpnlkkihgc^^^```^`^]^\\ZWTUTSSRQPPOOOONNMNMMKJIJIIHHIIHIIJIIIHIHIIHGFFFFGGFGHIIIIIJKKJ~}tprv|{||{}{y||}~~~}|{zzzwxywxyyyy{zxzxxywvwyzȬ~~{}}~}|}|z{{}zz{}zz{y|{yxyy{zyzy}~}~}||}{{}|~~woligilkkikmmoossrplkdb_`]]\[Y\Z`hd\]\ZZZZZ[\^`__^][ZZZY[^bccb\YWWWWW\fmjjjpyz{~y|}}z|~tx~~xsklnlmnmomnplonmnnnmonnnpry}|~~setvhhhjiihhiggghhfhfhhggeeehmu{{}zyyusrmlllkjjda`__`_`__]^]^]XUUUTSTSQROPPONOLKLLLJLJIIIIHHHHHGGIJJHHGGFHGHFFHHHHGHHIHHIJHJI~wrqvy~}{||}{~~|}~{{|yyzxvuwvy{yzzzyyzywuvz}à|~{}{z{}}|{}|}~{|{}y{yyz{{zzz~}}{}||~|}ysmkiiikkjkklnnopmnjhdba_^Z\Z[ZZ_fc^][YWXXYX]^]^^^\WVWXZ[_cdba]YXVWWVYdjkkklxzz}|~||yvwqmnmnmnmonnnnnmnmmnonnnoqt||}{}~}}~|pg|khijihhihhhhfggffghffeeffou|z|}yzxtphfjkkiiea`__a_^^_^__^ZXUVUUTRSRQOPPPONNMLMMLLKJIIJIGHIHHHJJIIHGIGGGHHFFGJFHIIIHIIKJJJyrsuw}|||{~}~~}}|||}{yvvwwwyzwzzzz{yvuvx{|͸~|}{{|{z{{|z{||{}||}zz}|}|z{zy|~}}|{{{|~~}{tojihkkjllkkmllmlkigcb_[]]\\ZZY]gfa`]ZYWYY[[[]^^\[YWUWY]dfed`]ZXWXWXY_gkikitxw~~|||}|vvpmlmmllnnmmnopnnmnolmpnpot||~~}}~~|}}lfmjfihhjihffgeefffghfeggehmq}xy|{yxrjfdhlkkhda`_``__^_^]^]ZXVUTTTRRRPQQPNONNMMLLKJKIKIIJIIIIHJJKIJIHHHHFHHHJHHGIIJIJKJKKKJztrtuz}}||y}~~~~}}}||{zzxwvwwxy{|{yx{ywutx~~ʭ~~}~|{~}{z|{|{}{~{|}}|zz{|}|{z|{~}~~}~}||}||~~{ztomihjhilnnllmkjgifca`^\\][[YYX[ggeb^[YYYYZ[]]^^\XVUWW]_ehf_\^[ZXWWYWZbjkijluy~}{{}}}x~}qmnmmnnnmmnmononolnnnnooprv~|{~|}}}}}{}{xggmgghihhihggggghfghggeggeglr}z~}zzsmfcehkkkhb_`__a`__`___^YXVVUUURRRPPPONOOMNLKLJJLJIIIIJIHHIIKJJKHIHIIHIIHIHGGIIIJJJJKKKK~{sruvx{|{|}{~~~}|||{yxxvwwwy|{z{z{xyvwy|~ơ~~|{z{z|}z{|z||}{{|zzzzy{{}|z{~~}}}{z{}||xwvpohiikjooooomkiggec^`]]]\[ZZZZ]gjgfa[ZZ[ZY[\]\^\VVUYZ^bddc_][YZWWWWXX\fkhkipx|~|{~}}qmlooopnpoonoopnolnnqonppsz~||}~}}~||{||ucjoehghhghgfhfhgighhgghhgefkq~|}}z}}{wlhecbfjjieaa`_a``__`_^_\ZWVTWSUUSQPPQMOMNNKMKIJJIIKIIIJHIJIKIJKIHJHIHIIGGHIHHIJJIJKJKKKL~uqttvy{~|}~|~}~}|}|{zzwuuuuvww{yz||zyyvuz~~|п~}}{|y|{|z|z}|z{||z{|{z}{yz}|{}~|{|{yy{|yxtsokhjnnonoonnlljgedc`^^\\[][[ZZ\fkhfb\YZZZZ[\][[[XWWY[acb`^]\ZYWWUWUVWW`jhijkx{~}{|}}~xnlmonmoppnooppoonnmpopoppt}}{}|||}|}{z{scmsgggghhhhhhighhhghhheghfelo|y}~|zy}xkcebdgjjid`_____^^`^__^[XWWVTUURQQPQNPPMONMLKJJIKKIIJJIJHJJIJIKKJJFIHFGGGHHIIHJJKJKKLLJK~yvuvw{{{{{}}~~~}|||wwwuuvwxxz{{{y{{{wx{}}|~~ζ~~~|{||{{~{z{z|z|}{z}|{{{{||z{{}{~~~}}z}}z~}~{{zwwspnmpnrspppsnomljfeb_^]\][\[ZZ[\eligb\ZYZ[Z[\[\ZXXWWZ_aca`\[[WXYXTTTWVUWehhiitz|~||~|~~vmlnnnooooppooopnnnnoooooqv}~|}}{}{{{zzpbsziggghghiihhgghhhhhfeggfggnw~|~~zvxzledddfikjga^]]`a^`__`^^YWVUVUSRSSPPPPOLNLLMLKLLLKHIIIHIHIIIIHJHJIHHIHHJGFIHIHJIKKKKKLLLK~zuvvuv||~~}z}~~~}||zywvxvuvuwxxzy{zzzyxvy}~}{ͯ~~{z~{|{{{|zz|zzz|}|zzz{zzz|{|{~~}}|||{}z{{z{{z{uqpqopqssosrrrnjliecc^]][\Z[ZZZ[\hnkhb]\Y[Y[[Z[\ZXVW[^beb_]\ZWVWVUWUUTTUWahiifpy{}|{}|somooooonnppnopoppooooppptz}|||{|{z{{y{lbrlffhhghhihggghehhgfhhhffhmsz}~}xtw}}|wlededfikljgb```__`^^_^\YWSWUSRRSPPQPOMMMLMKMKMIJJIJIIIJHJJIHJJHIKIHGHGIHHIHHJJKKKKJLKLKL|vwwuvz{{~~~~~~{zz}~}}|{yxxyusutvwwy|z||{{zxwzz}~}|~Ƞ~}{zz||{z{zzz{|{~||||zz{z{|{{}|~}~|}{||{}{|}}|zwsqvutststywvsqpnlfd`^[\]Z\ZZZZXZfnlgb^ZZYYZ\\[ZY[YY]adfc_^[ZXVXVUVUUSSTT[fjgfiy|z{{|~}snqmmmnnppqqoqoqoooqqrpprt~|||{{{|{{z|~k`hlghihfhfgihfhfgghgfgggheilq|||zvtx}}zvspkdceffjllkjfdb___^_^^^\YWWSUQSRRRQPPONNNMLLKLJKKJIIJIIIHIIKHJIIHHHGGHHHHGIIIJKIKJKLLJLLL~vvvwvyz||}~~~~~}~~}||{zxuwyvvvuuwyz}{~}|{ywy{}}|zzĕ}}}{}}}z{{{{z{y|||}zz~|{z{z{{{~~}~|}|||{}||}zzuvx{yxvwwz{xusnljfc`_[ZZZ[YZZXYYfolf_[[[[][Z\_\]\[\^dghc_^ZWXWUWUWUVUQSVWbighfv{~z{}~pnonpnpprmpnoossppqrqqoosv}||zyxy}zk\Ypnghhhfigghheeggghggefffegls{{wxz{vv{{ywvsqonkedfehjknkjhgeba``_^__[XWUTTRTSQPQOOPOOLMMMLLKLKJIJIIJIIIJKIIHJJJIHIIHIIHIIIJIJKKLLLLLLK~xyxvvx||}}~~~}|~|zxyxxwwyuvuvw|}}{}|{{{y}|~|}zϺ}}z{|{|z{z{z{{|}{{{|{||}}|~{{}}~~y|{||~~}zzz{zzz{yxvxzyurljffc`]\]Z\ZZZW[[\hqle`ZY[\Z]Z\^^\]^^cfjjd^]]ZWVWVUWUVSQTTV[feggs|~{{}~}onppopqnppompsrsqqpqrpppty~z}yg[T^ngggfggiffgegggghfgeeefeglpx~|wqry{xuvvuuuttrrpfddhjloqolhhfea````_^[ZVVUTSSRRRQQQOOOLMMNMLKLKLKIJKKIIJIIIIIHHHJHHHJIHIJIKKJJKKKKKLKLMzxwxwy{|{{~}}}~~~}}|{{yzzxwvvvvuuwz{{}}}}|zyxz|~~ͯ|{}zyz{zz{|{{|{{{~|{{|{}{zz~~~}}|~}{{}~|}{yx{{|zzyzzzwwrlhee``^[[[XXYXWYZ[iskc^[ZZZ\[[\]]^^_dehhhb^]\ZXUWVUVWVRRTSSV_feep|~{|~}ppornqrpppqrppqqqpqpoqprt~qe][ovgfhgihghghgdegfghfggffffhkov{ztopx|xtrpvyyxxwvtkffklmrwvqkggeca`]^_^]ZXWTVSSSQRPQPQPONNNMMKKKLJJKKIIIIIIIJJHIHHIIGIHJJIIJJKKKLKMKMLLLKzyvxvyyy|~|}~~~~~~z~{ywxxwwwvvuwvvy||~~~|{|zzz}~ȣ|~|z|zzyzz{{z|{}{}}z}{}{~{~}}}~}}}z|~|{z{z{||}{{xzzvvoiebb`]^\ZZWXXXWYZ[ksia^\[[\Z\\_^__]`fgigda\\YVUVVUWTVUTRUUSQYagfk|~}{||{zqrrqrrtppqrsospqoqopoppqu~xtzjagggiigghhggghhfgfffhegggioszwsnnwzttopv}|{zvvtmgjkmmtzxvplhgcb`__^]^\ZXWUTRRQRPQQOOOMMLMKLKLJKIJJKJIIKHIJHIHHHJIHJIIILIIKKJKLLLLLLLLLzyvyxx{{{}||}}}~~~}zxyyxwwtvvwwxxz}||z}|~|zz{~}~ѽ}}}{|z|yy|y{{||{}}|||||{}~~}}}||}}~~~}}{{}{{||~zxwxvtqmhgc_`][Z[ZYVUWVXY[lrh`_\Z[]]]\]_]^`eehgeb^ZZZWUVTUWWVSRRRQSRU^efgz}~{z{~wrrusttrvstuurpponppprqqqyvnhghgihghfgfghgffehggfgffhnqyytrquutopsw{|z{zyxunonnpxzywurlhcba`__\\\Z[ZVTSRSQQPPNOOMNNMLLLMJJIIIJJKJJIIIJIHIHHHJJHIJJKKKLLLLLLMLLLLLzxxuxyy|{|}~}~}~~~z{yywyxxwuwvxx|||}||~~|{yz}~ͳ}|{zy{ywzyy{z{z{|||{{~|||}~~|~~~|~}~|}zz{z|}{|wwuspmigcb``ZYXZYYXWVWWX^lqgb^\]\[]^__`__acfgfbb][YXXWWUTWVUTSRSQQPRXbfet~}{||srrrtststvvvvtrpnpoopnppqz~jfgggfffgfgfgggffhgfefgehms{{zwuturpru{~}{{zupnot{zzyxtspjea_`_^]]ZZYYXUTTRQQQPNNNMLNMKMLJKKKKJIIJJIJKKHJGHIIJKIJJJKLLKKLLLLLLLLLL{xyxxyy{{}~}|~~}}~~~~~xyzxyyyvwvxxz||}}~~~|}{y|ɩ~}}{zzz{{z|{{z|{}{|{{}}{|~|~}~}~~~}}{{z|~||xwutpmfebb_^^[YYXWZXXXZX^lnfa\\^]]\^`````adffcb^^\[YWXZYVWXWUTSOQPPRS]hfn~~||}stusrsstvvwwustpppnnoprrrmehhhghffgffggfghgfgffgeglrx{vsprtrmr}}}xoorx|{wwwttokhfa```__\[ZXYWWVRPQPPPONLMLLLLKKLIJIIIIIJIJJKLHHJHJIKJKJLKMKLLLKLLLLLLLL{xwxwyy{||}~~~~}{{|}~|y|xwxzwvxwx{}}||~~}{{{~œ|{zyyzxy|{{||{{{{|{}{z{|~~|~}}~|~}}}}|~}|}~|}wtssnkfeca^^ZYXZWXYXXYZZ]lkc`^\_^^^]```abdghec`_^]\ZYWXYXWVVUSRQQRRRSZcgj{}}{}rsstqtsstwwuutrtroopnqoqvofhhgfffggfgggghggefffgddjpswponowwtw~~}}ztnsz{|xyvutokjigd`_^^_]ZXXVVVUUQPNQOMLKLLLKKLKKKJIIIJJIJIJHJIJJIKIKJJLKLLLLMLLLLLKLMLyywwxzz}~}~~}|}{{yzwxyyzz|{~~~~~|}ɯ~}}{{{{zz}{z|z|||~{|||{z~}~~~~}~}}}}||||~~{|yxunqmigd`_^^\ZZZYYYYWZ][bnlb__^]`_ad`abcceegfcb`_\\[[ZYWVXVVTRSSSSSRRT]ghu}|{svtsttsstvvxwuutrqnooopszrghjhfgghgfgghfhghfgdeeefimrtqnmn{~||x}}||~uprsyzyvvusljijgjec_]^_\\YWUUWSSQOQOOLKKLMMMKJKJJIJKKIKIJHIIKJJLJLLLMLMNMKLKLMMMNMMMM{xvwwx|}}~~}}{~~~ywyxwyyz{{y{~}~}~~Է~~}~|{{yz{}}||||{{|}{|{}y|}~}~~~~~~~~|~}}~|{|}|}|yztstlgab`]_^XYXZ\YY[Y[Z_anle___`_`ccbcecegfffbaa^\^\[]YWXXWVTTRTRPPQSSXbho{~||~ttusssututwxxwurrqqnopnr~xhjhfgfegghhghgiffffdefeehopsqnmnyzus{}}~uopoqrwwwupjlkhggfec`__]]ZXVTVUTTQOQMNLMKLMLKJKJKKKJKKKKIIIHJKJKKJLMLLMMNNNNLMMMNMMMM|zvuwwyy|}|~~~|||yxy{zxxyy~~~}~ͥy}~~|{{|{||}{{}}}}~}y{{~~}~}}}~~~}~}|{}}~}wusmjib_^]Z[[XXXZYZ[[\]fpkfb`a`^acebecbfhhgeba``^_]\[ZXYWWUUTUTSRPQTRT^hiz}{|}rttsuuttuvvxywtrqqopnnpu|ihhffhffhghgffffffegeedbglquvutu|~uqqz~}z~xqpnlmoqsspjjjghgbfecca]^\\ZYUUTRQOPMNNNLLLKKLKLKKJJIJKIIJIIIJJLJLLLLLMMLLMMNNMMLLNMN~yvstwxx|~|~}~~}xyz{~}||×}|~}{{{|z|}{{{|}|}|}{zy~}}~}|}}~{{||}}~}~|wvtsnhd`^^^Z[XYYZZ[[]^_grjfeba`adcdecfefiihdaa^a`_]]\[ZYXWVVUTTQRSRSRRXghu{{{tustusutxuwwytrpsoopoopykfhfhhghggfefffeffffeedcgkq~~|rruz~}{{}xsronkjjloojiiiifcbbaa``^]][ZXUSSRRRQPNNMMMLMKLLLLKKKJJKJJJJJJIKLKMMLJMMKMMMMMMOMNNMN}xtwxyyzz}~~~~~|~}|{}}|}}}ӯ{}}}}{zz|{|}{}~||}|y{z{}|}}~|{|}~||~}|}|{{vvvuqidba``\Y[ZZ]Y[\\^ckslfeec`bdedefefhkjhfdaaca`^^][[ZYWVVUQRPQSSRRQS_gn}|ttssustuxvvvutrqtrpnnornfgggghhegfegggfgffeeefcgmr~|}yrpsw}{xvxvutqomkiihkjkiiigbcb`_^_`^[[ZYYWSRRRQQPOMLMLMNLMLKLJKJLKJJJIIJJLLLMMKLMONNLMNNMNNNNON}ytuvyxz{|{|}~~~̡z~}|||}y{{{|}{|{zxyzy|}}}~|~{|}||}|~{|}{{{~~~}~yyrrrqlhed`^[YZ\Z[[]Z^`dlqmhhfffddgffffilkihfcb`bc`__][YYWUUTTSPPSRPSQSRXdj{}ysttuwuuvvututuqqrrnoootodfgfghggfggffffeeeefdecdjpy~y{{uroo{~|ywtsqtvvroljjhghikigdaac`^]^__]]\YYWVTRRQPPQONONLLLLLLILJKJKJKIJKJLLLMLLKOMLNLMMNMMNNNNNNyvutuvxz{{}~|~}~~Ҽz~|||z{z{|||ywwxxyz~~}}|~}~~~~~}|}}|||z|{||}}~}~}{xywtspplfea`][][]\\[^`beglqnlkhffegehiiilkkgfbbacd`^]\[ZYXVTSSQRQQRPRQSRU`gs{~xtxuwwwvvwtsttsrppqonnpwrghehggfgfgffedddeeeedcbejnx|vzxspnpy}|xxuronrwxutpligfffgggeccda_\^]`]^\ZZXVUTSQQPOONOONMMLNLLKKKLJKILIKKLLMLLMLNLMMNMNMMLNNNNNOztuvwxy|}}~}~̪|~|{|{|{{|zyxuvxvuw|}}}{{}~}~~}|}|}{z{||{|||{}|}}~}{zywwvqrpkjhbc``^]]\[[^`ffhnsqqljgffgggilklkihhcdbbb`^]\ZXVUUTSRRRRRRQQRPRSZfk|~{xuvvvxwwwwtsqqspprqnmorzyfgggfgfhghfefedddededdcdgmuytwsolmowzututrnmpvyxwtqmigfeefhgdbdaa^^^\^]\ZZXVUUUQQPNNOOOMLNLLLKJLKKKKKLKKJLMLLMLMNLMMNMNMNNNNNNOO~yttwyyzz|~}~~~}~~~~~}{{~zw{yvvqrvvy~||{|~~~~~~}~~~||{{{z{y{}||~~|}z{|{xuqrrmljhfdba^]`_bcdghmwxuupkgggghijlmnnkeedcbbc_`^ZYXWUSTQQRQPRRRRSRRSScht{}ywwvvywxwutqqssrppnnonr{gggghefhgfffgfedeedeedcchlt|xwvrsruyumputqomotwvwwuqnjffeedfdec``b`^_\\[[[YWUWUTRPONNOPOOONNMKKLLKKJJLLLLLMLMLMLLNNMNNNNMNNNONOP}zuuvvwy}г}}~}~}}|}|zzvtttsuu{}|{}}~~~~~~~~}~|z|}}}{{}{}{}~}{{~|vronoomkgfeecbbcedgjkjo{xxtqlhehfiijlnonlfedcbcb`^^\YYWVSSRSRQQRSRRSSRRS]jm}}vvvvttuwvvqpqqqqrpnonouifghhfhgghhgfffefedeedbaflr}||}|slgoutqqopvzxxvvusqjiheeefcdbbaa``^\ZZ[[ZYWUTTRPPONOPOMNNLMMKLLJKJKKLJLNMMNMNNNNNONNONNOPOOOOzwvwtuy{~~Ǣ~~}}|||{{|yxyuutsuuvy~}}{{}~|}~}}~{}~~}z{|zyxy{yxzzy{}}yyzxsnikjjljhnllkigihhjjljs}zvspkheefikkooojgedddfdc`^^]XXWWVRRSQRRPSSSTSRRSVdlx}wttuvwwvvusppqoppnpmmpxlfffggfgfhgfgeefeeddedecgkqwlhglssroosvzxxvvuttpmigeeedcdbb_`_]\Z[[[YXXUSTRRQOQNONNMNLMMKLLLLLJLNLLNNLMNMNNMNONOONONOOPOP{yvtwww|}~Ϸ|~~~}|}}zyzwvvvuttuuw}|{{{|}}~{~||}}~~}|{yxzxwwxvyxxzyxyz{{yzxsqlmkkpmmqponkijiijljlv~ytqnjiggikllmnmkhgdefeebb`^]ZXXWURQRRRQRSRSTTRSST^lw~~uuvuuwwuvtssonmonnomns}peegfhggghggffffeededcb`ejpylgfgirroprvxyzxvvustqpnkheebecb`^]^][[\\ZZ[XVURSSRSQPOQMNNMMLLMKLLJLKKLMMLMNMOMNNMONONNOONOPOO|wvwuvxx}ʧ~|y{y{}yxywvwuusutu~~}{{{|~|}zx{zzzzywwvuvyxxyvvvzz{{z|x|z}~}}{wtrsonpoptturnmmjlmlkmxyutplihjklnqqrljjfhiigfdcb^][YWVTRQQPSSRTURTTSTSRXh{{~yqqndbca]_`acedfkruuvvustrqqnoonnnowxyxxxyxxy|}rehhegggggffffeeeedddccbeiq~}}{tifgegpsrsuvwxxwxvutssopmjiffcbaa`]^^Z[[[]XWXXUVUTRRSQROONNMONKLLLLLKJKJKNMMMMOOOOOOOOOPOOOOPQP}yxvuuw{μ~~||yvv{{yxwvsrttwv|~}yz{|~}|x~|{wuvvuuvwvywzyz{z{z|{{ywxz~}~}zwvvvspssvyzvqpolmonpr|}xtpkjkmmnoqrrnkjijjffidd``_]ZWSTRQOQSSTRURTSSTTQUaxzw~yqig^XVRQLNRWVXZU[YYZZZZY[\ackrvwwutsrooooommqwxxwywvwuuvxyxwwxxwyz~vgggfggffjgfgfedeebdddfcdhoz}{yxxujgfdenvwvvvwxwxvwvsrsppnllkhfda_^]^][Z\Z\ZXWWVUTVRRQQPPONOONMLMLMMLMKLLNLNNLOOOONOOOOOPOOOPOPP{yvvvy{}˧~}zy{yxtwyxwyvtussvuv}{yy{z{}zw}|{ywxwwvvxy|y{||zz}}{zzww{|~|{~}~|wvurqtux|{wupnnnopqv{vpmjmmorqppplljkkhhigfeb`]ZVVTQRSRRTTTRUSRQRTRRQWfqoxwmj_ZURSRONPOMPUTVT]^^Y^^\[\]]]]\^^_]aowvvvsrropononnq}~yywxxxxvwuywxuuttssqqqpqruvwy}{gfghgfghhghgffeeeeecdecegow~||}|ogfeemvyxutvwwwvwvutsrpommihhea`^]]][\\Z[ZXYVVVUURSQPQPPOPONNLLMLNMKMOMLMONOMMOONNONOOPPOQPQRR|xwwvyzн|}{xxwwvtsvwwvtttrttu}{zxyz{}ywz{|zxxvxwxyyz{{zz{{|{yzxxz{|~}{z|~~zurrqtswyzxsqqrsuvw{ysolooosqoollnkjkihhebcba\ZXWTRSTSTTTTTSTSQRSRTRTW]jo|~umeaZUNLOMMOORRUSTVWWZXZ^\[]^^c`a`bbcdbabc``^evursooonnnomllr|wwwyvwwvvwxxxuutstqrrqnnmnllmnmmrstuwxz{|~ighhgffggggfeedefecdcdbdgmt~qheeflwywwvxvvuvvuttrqpnllkkjheb`^]\ZZ[Z[ZXWYWVWTRRRRRSRQNOMLLLLMMMLMMMLMMNNNMOONONOPOPOQPQRQP}ywxxyz~ɩ{}}}{xyxwvusruttursrrvs{|{zyyx{~yvy{|{ywvvwxz||{zzy|||zxzzz~{}}|zy|~wwtrqnsuwwxstvwzzyyyusonprsoronmlkjiiigdedb_\[ZUTTTWVUUVUTTUSQQSQRRSTW\gqywnbZTTOMLOQPPPPSSTVVTUXWZ\_agejjknkjllkjkkmkjjhhkihhospoonmnmnnnmox|vwxwwxwwwvxwwwvurqqqonnnmlklnkjkllkjklllmmnpptwy|kefgihghefggeededeecccedelt|zumfeeekvzvwxvvutuvttsrqonmmnmljgeb_]][[[YYYXXWVUTUTSSRRQRQPNOMMMMMNONNNNLNMMOONOPNOOPPPOPPQQQOS{{wvyz{м|~~|zwxvvwsqrvuttprqsux|{zxxyy{}v||}zxvwvvx{}~{}||yz|yz~~}}~}|~{|z~{xvusrpruwyyxyx{{}{}|wvtrptusuqopomlkihhhgcca`]ZXUXVWTUUUVSSTSSQSSSTSTXXYgx{qaXRRTPPMNPRTRSSRRSRUYZ]dbcigijkknlkmmlkiiigghikfgihhkjlkoqnnnomnmomllo{}wwwywxwvuvxxvvussqrpmpnmmlllnmjklklmkjjjkjjkjjmklmsnehghhhhgfhgfedeefedcddcejr}yxuuslheeflvyxyxvvtssssssqrpoqpookkihda`\]\ZYYXYWXWVUUSTSRSPRPOQOONNNNNNNNNOMNNOOOMOPOPOPPOOPOPQSPQ{zxxwyz}Ȩy~|y|vwuustqqqqtsrrrsts~|}{zxxyxz~~x|{{xvwyxxy{|}{{{}{|{||~}|}~z{yyxzxvwtrsvx|{z{|}}|~zxutuyxxwvrrqmllihgjfcaa`]\ZXVWWVWTUSSRTVSSTTTUUSZ^X^nwkaYSOONLNQURTTPQRPSUV[^_dheehkhjjhhhhihebda_]\]]YWYZ[XZZ[Y[_chmoooonmmmmkjkt{xyxxxwwwvwywwutsrsrnknmmmlnlkkjkllllkjikjijjkkkkljrtfhfhghfefgfeeeeeeedeedcejpx|ywvvvtokffipwxzywvttsssrqrqrstpoomljihfeb^\[[ZYWWVUVVUUUTRRQRQOPOOOONNOONNMNMLONOMNNNOOPPOOOPPQQQQRRzzwwyy}ηz~}{|zxvxtvsruqpqrrttrsrsz|~|zwwwxxyz~y{z{xxz}zxy{|}}|{~~}}}~~~}|{{yzxyyyvvvw{{||~}|}~z|yxz~|zytsrqnmhgghgfeba`^[ZXXYWWUUTUUSVUVVVUUUUZaYUfwqd[TPNPOPPVUTRUTTQRQW\]abcfiifhieefda_[Z[YVWVWVUWTWZVVXVUXWXWYWY]Z]hronnmnmkmlkmw{ywxywwwwxvyxvvussrnnnoolknnnnjkknmklkjkjikkikklkkksvfhgfgggfgfgefeedcddebdadjpw|{ywwvvtqjgjntxyzywvtrprpqrtutusrqnmkiihfeda`[ZYYWVVVUVUSRRSRRRQOOOOOONONOOOMMMNOMPNNQNNPOOOOPPQPRPQQQ~zwxzy{~~Ũ}vz|{zywvuusssstrossswwtux~~zzzwvyyy|z{{zy|{}y{{|}||~|}~}}~~}~|~{{zz{{{ywwz~}~||}~}{|}zwtornligfiggffba^\\[ZZXVVVWVVUUUWVWVYVVYc\Q`oueZTKNPQTUUWWUTVUUTW]^_dgffffiedc_^]YVVXVUTTRQTTVXXWXWVVWYXZZXY[ZZXZ\][droolmnmklklp}zzyyxxxxxwwywvxtsrrqoponnnnommkmkklknljjijjjjkjjjjkt{ffhhhghhgfeddfeccdaddccbhnu{|yywvttqkimuyx{{yvussrrsuxwwxturrnoljjffddab`\ZXXWWWUUWUUVSSQQQQQOPOPPOOOOOOOPOPOOPOOOQOOOQPPPPQQRRRT{yzyyzϷyv{{yywywvuusuorssuuvwxvv|{|zyyyyz~z{}~~|{z||{~}~}}~}~}}||}}{|~}{zyvsspjihhhiiiggfc_^^[]XUTUVUSUVVVVWVZYY\a[R[mtwi^URQQPQQTVWVVUTVW]`bfijijhge`^[YTPRSRTUSSWVWTSQRUVXVVWTVWXZY[Y\\[[][Z]\[\`oomllmlkjjjr{yyyyxyxxvxyyxwvttsqpqponnnnlmlmlkkklkkkiijkkjkkkklviggffihhefefeedddcdddcccemt{||zvvtusnoty{{|{yvvurrvwxyzwvuvrqomliigedcb``_^ZWWUUVVTUSRURTRQOPOQPPONOPPOONPPPOPOPPPPPPPPOQRRQRQRRS}}{zz{{|Ĩyx{xyyxyvwvsvqsstuwxyvvy~~}{|zz{xy}|{{}}|||~}}~~}|~}}~}}~}z{xvurpnlhhjhjifgdba`]ZXWVWXVVVUVWYXYY[]bbYQUnpzyeYRONRRTTTSUVWTTXY]`fgighigb^]XTQQPQRQRSSUVTXXWWXUXWZYY[ZYY[XY\]\\]]_]]\]][^\_mllmkllkkjlv~{zyyyyxwwvywvvvvtssnrqqqoomknlkmljmklllkijllkkkkjmxkegfffffeedeeedeeddfdccadmtz}|{xzwxyvvx||~|zyxuttvz}|zywwttspplkijfeedaa__\ZZWWVTUTTTTSRRRSRPQPPPOQQPPOOOOPPPPOPOQQPPQQRQQRRQQSRR}||zzy||ήtwzyyxyxxxvwwvxuuwwywww~~}zz|zyzzzz|}x|~}{}}}|}}}|zyyyuvrnkhjgklhhgcdb^\ZZYYWWWUUWWWYY[]cebWTVkrp}eWPQRTTVUUURRTUSY^cfghgfa`[YVVVSTSUUQPPRRPRTUWXWXUZY[^``feddoldfnigimf`dcb\^]^]^[hnlknjlkiil{}{zxzxywvssppoopoonnmnolllnnmlllkkklmlkkkjknzmdeggfeeefedeeeecdbddeccdlpz|{}|{{{|}~}|zxuttz||}yywustqqmkljheedbc`^^[][ZXWUSUTTUQTTQPQQQQPPPOOQQPPOPPPPPOPPOPQPQRQPQQQRRTSR~~~|}z|y{|~һxu{z|{|zyzzywxzyyxzyxy|~{zz{z{y{{}~y}}|z||}~|zzzywtpoifglighgded_^[ZXXXYYUWWXYZ[^acd`WTWistunZMMSUUUUTSRSSTWY^afefdfb[UPKMNMOTTTSVUQTURQVXWW^dizmj|nnoqzxxr~mjk`\[drooollkjhr~|zyusropoookllkmlkkmmljklllllnlllklo|refffffefgefeeeddcddcb`cchpsuw|{{}~~~|{zvtuy}{{yyvussqqoljjigfbaa`^]]\[[YXWWUVSTSRTRRPQPQQQPQRQQQPPPPPQPQPPRQRQQPQQRQRRSSSS}}}~{|z{{{ƥ|z|}||{{{y|zz~}~~z||{||{z{}z}~~~|zzy{{yxojggihgfhgec`^Z\ZYYYXYYXYZ[^aacb^VTUdstswv_TPTSRTVVVVTVUX^_dfegf_]XVRMMLMONOKQQTURTW`ajiapp{y}{nykhwvwvvtsrpw|yx{||}~~{|ywtspnnnmmmllklllllmkjllllllpvffegfeefffdeeeddcddbabcbiooou|}||||{zvvwyz{zyyuvssrqnljijjhhdc`d^_\[]ZZYXWVTUSSPRRQQQQPRQSQSQSQQQQQRPQQQRQQRRQRQRRQRRRRRT}}{}||z|~д|}}~}}}}}~}~~~~}~~|~}z{{|{wplggfeffghfc`]\]]]\[[ZZ\[[^^a``_\USUbpssttlZRQUSXWVUVVTVZ`ffhgfe`[YQRQTRONPONPSRTVZcjtkqm}zf{`zv^xo`|n\jnvm}|oyzzzyzyz{zzz{xzzyzxvvvuuuvv{y{{z{}~}~~}zxzywussspnnmlklljkliklloyihhhgeeeggffgedcedeedbcchnqsx~|{~}}zzywvw{{{zywvutsqonkljhffdecca_][\[YXXWWXWVRQSTQPPPPRRRQSQQQQQQSRPPQPRQRRRSSRRRSRSSSSTU~~~}||z{}¡y~}~}~~{~}{ysliegfcdggfba^__^]\[[\]]^^`a```\XTUV_kstustnRNQTTUUWTUTVWZchjied`[STTRRSSRPPQTVWWchwjum{gc}\^}w[V~lXm}nYtp[tv`mbh`tdxtyyzyyy{y|{{|}|yy{yvvtssrrtsuuwxxyxyz{{yyywxwutrpppnmpmlp}hffggeggfghffeedeeeeeccdhry|~~}}}~}}{zyxxwvuwxyzzyxvuuqpqlljkhjedd``^^]\[[ZYYXXWTVURQQQPPQPRSRSRQRSRQRRRUQRQRRRRRSSSTSSRRRSTSU}|}||||~ɬz~~|~{zxsnkgeffceecb`a]\__^\]]\]_``ca_][YUVW_hrtvvrylPJRQWXTQTTSVY`dhkie`ZSUVUWWTTTWU[\^jvl~}~~pkcZxbVe}cVq~[m\o_r^}da{qi{e~cy~xwwywwyz}~}ywuqqqppnmrpqqrtvxwxxyxwxwvvuutwjeeefegefgfeffeeedeeddddgt}~~|}}|}||{yyxvvtssuxzzywvtrqpnnljiigda^_^]\\[ZYXXYYUWVWTVRTRPQRQOPRSRRRSRSRRSSRRRRSRSSRSRUSSSSUSTTU~~}|}̴}~}}}|||yuqnmkefceedcbbba_a_`^^_^aaab`_^^\XUWY]enutvttwuTFNRTSSQRQTTZbikhhc^XXUUWXXYYXY[bnvr{Zz\PgqbThv`f~lmnxw}xnnooxkv~~xwy{~~}ywutqppooooqrssuwxwxxx|lfgghgfhggffegeceeeedeedgt}|~~~~}~~}||{zxxwvusruwyzzywvtsqonnlkifea``__^][ZZZZYXXWVVTSSSSQSQSPRQRSRRSRSRSSSTSSURSTRRTSSSRSUVTVUW}~}}ϻ{~~}~}~{~zunnkkleebeeccaa]a`ab_a`aadcbaa_`_[YWY[^bituuuusscHGNRTQOPQPTYchkjha\[]ZX[YWZ\_grzkyz{booPUstkVZp[m|spgjr}moj}w{}{wvtrqpqqopoprvy{mfggfgffggfeeedddfcdddbcfoz{~~~~|}||{zyxxvuusrsvwyxwvtssrommlkhgecaa``_^[\ZYYZXXWVTSTSTSSSQQPQQRQRRRRSRTSTSSTTTRSSTRRTSSTTTUVTUͿy~~~~~wqokmikhededffccabccba``bcbdeca`__[XZ[\^afpvxwvuur{zSDKLNNPNPMQZbfijg_\[YZ\\^^citjnsp]w\TktfPlg}}xzqaze^[[yX`~WdgU^whv}msu~zxwu{{yumgffedefgefedfeedefedddddlxz{|~~~|||{zxywvsssuuvvttssspqpnmmjjhecaa``^^\\\YYZZXWVUUTSTUSVRRRRQRRRRRRRSTSTSSSSSTUTSSSRTSTTVUVUTTª{}}~~~srmlkjjfeefebbaeeccbcabacdefbb`__]\ZZZ\]bflvwxvvvtqsrMBIJLKMMOPU^dggfaZZZ[]\]`bcvrixhY^ssXf}}i|diWmfPdlVa}wgWozhWo|f\rx[qv^rt[ukxy}j{{voomighggdfegeeedededecbdivz}~~}|{zwwvtttvvwtpmmmonmonllkkieebaa`a_]][\[ZX[XWWVUSUUUTTTSTSSQRSRSSSRRTTTSSUTSTSTTTSSWVUUWVUVVƬ|~~}}ztpmkjjhgfffegeddefeedigdfeggdd^]`][\Z[[^achv|~|}|z|{{zdADHJKKLKLT_fghe^Y\]\]]\am{{kvj^Yve[pjz[jnTY}p^Tfu]]tmY^|`yiazlggjubt^pxm{vsrmkihhfdeedbbccbcis{~~zxywvuuxvvpnnliklijkkkjhefdcbc`b__^]\\ZZYYXXYWXUTUVSTUSTTURTTRSSRQUSUTTTSSTVVUUVTTUVTWUTVVWɮ{}~~~}ztpkjjkiigfggfggffihihkjhffijf``c`^\\\]\_cagv_CEHKKKLKOVcgjha][]_`_clqd|~z^bytYl|zeMzrUMiv}bQe~[thyr|~|~~{n`}nomxk|}yvspmliggfcbgr|z{zyyvrooonmnmkkkkijiffdegfebaa`^_^\\\\[Z[YYXVWWWWUUUVWUTTUURTRSRSRRSUUVSTTUTVTVWTVTUUWWVWWǵ{~{vtmijiggiiikiigiggkhilolkijkkhgda`^\]\\\_bbdo]FCIIKJNMQZage`^^^a^^b_ns`{r]]skemUigMNir{Qevgt}zrr_o^~g\efvZes|{zhnvpz~{ywrooy|}|{|yqljjhjjkiiiijggddedfffddaa_a_^\\]YZ[\YWWWXXVVVWVVWTUUUTSSRSTRRSRRTSTWTVUVVVUVTTTUSWWUUɸ|yvqlkjgfhhhkllkkkjlnlmnppmlmmmiffa^][[\\]_a^cfv|~~}|}|}}~|_CIIJKJKOU_ea^]^abbaamzel_Wl{{s|tbZrdP]flR{j}o~\wlVecL`lOZ~mPZnYayaYjQyoSspxiugz}{z{sliheehjifeeefffgiihdgffcaab__][]\\ZYZXWVXWWXWWWWUUVUUUTTSRSSRSSQSSSTVVXVVWWWUUWUVTVUWV¾ʼ}~~zwsolijijkklpqojkoomopoqqnpnpmlhc`_`^[]\]]_`bbkwxyy{y|z|{|{yxhGFLLLNOPV_b]YW\``cee`wqm[|uZtx}w]wl[VjvYltui|}dWpUL|xgJ]ox\VonRpvUsyXuZmgjw_nifyZ}zmn}}}wrnkhfgjjifeedfgnnnkgddfedbb`^_\^]\ZYZYXZXWYXWXVVVUUUWUTSSSTTUSTSSSTTUUUWVVWWWVWVVWXWWWV̽}}wstrnmommooqqqsppppnouppqqpppnkicaa``^_\^]_`a`htyz{y{||~|{}{{zyqKKMOMQQQ_ffbWV]^baeyujhaWpnz\{ZNprzbp{[}dMubKWnqpOdxj^gmp{bp{uocpipepr|po}{uvuokiiihgffdgjmonlkhggfdcbbb_`^]\\[ZXXYXXYWWWWUUUUVVWUVTTTTUTSUTSUTUUUUUWVWWWXXVVXWWYXW˿~vtsrppqststruwxvustqpuusrsoqqqmgeda``_`_b__`^`dqz{|~|}{}|||||{yzPKNNLPSUdmmeVX\^``\dyyhYtfvsvVYss}Zw~z~dnjNRyn\JfqhW_rxjjwpyijfsq|sxzvxvrnnikhfeeimrpmjmmjggeccbbb^_]\\[YY\ZYXYWXXYXVWWUTUVTTTRUTTUUVUTTTTUTUVVVXYXVVXVYXZXYY¿ȿ~vwwutstwwxvuyy{ywttvyyutpomqomggeedeccaccb^aa_dmz}}~~}}{{||{{y}[LOQQOMVdjpm`_\\\ayflhn]szjWxiZzoz[tWLmuuUPhYp}xl]t_X~PTq[XyS]gT~Wwf|kymknjv~xsusorqjgffhlnqqolkjlkhfeeddca`]]][YZYXYXXYWXVWXVUWUUUVVUUTTTTSVTVUUVTTUUVVWXVWXXVXXWXYYY}{zwvwxyyxtyzyxxzwwyxurnmnoljfffigfffeegb`_`cdjy}}}|{}|{yyz{z~nMPXVRNVakkligb`aWlpuS^su\zxgTexyxjsaMYqpqP`|pkuzX}dKibKYvrWVqvjPiuqSk}dUmoSnuZhpRoqTqjyuqmvyvvvwxzusrmnvrkgfknnhelmljjjiffdcaa_`^^^\[[\YXYYXXWWXXVWVVUTUTUTSSSSUTUWUVWVVUUVVVWWWWXWXXXXXXYY¿ʼ|yxzz{zxy{}|||xyxzytqpqqmjhgijiiieghffda^`cgiu~~}||{|z|{|zxTQX\YTP\gihhgggki^~qcmYXnx_}}f_Mvz}Y]uh|jxRt`MV{l^L]ngUvyUwX~^~ebuyasXkbh]~W|vxrq{vpifgkmopnotqnkjnmf^_inmkjjhgeddbab___^^Z\Z[YZXXYWWWVWWWVXUUSVTVSSTTVVWVWWWVWVWXVWXVYYXZXXZYYZZȻ{||}|{}yz{{~{yuttqokmpnmkifhkkihgeghebcbbegkr~|}}}|}{}}||{}hRY^^ZWYab_acde^jwngRmxpX|yyZ|s\YucMj~rqw^RkQImrzXPdz[spwyxz~yvtzpyjhkxccstv{vxxlb[YY[`dgilmmlljhif^`illmhhfeeedcab^`^`]\\ZZYZZYXYWWWWXWWUVVUUSUTTTSVTTUUXVUVWVVVYXXWWZWZYZZY[[¿¿¿Ǻ}}~}}}~yx{{xvvuqqqmmomklkikjiiiigfcedcfddghko{~|~~||}}}}~~yTZ`fd_Wab_^_fcsf~]w}cxh[OiodqmQSlgmyaNzaLRhxxPejmr{{h~\w[sZr_}boe}l}w~{i~gglgzuz~}ug_XUUSRW`fghijjjfadedfjjkieca`bcdd`a`_^_]]]ZZ[[ZZZXXWWXWWVVVUUUVUTTUUUUTWVVUXVVWXYWWXWYYYYYYZ[Z[Ÿ~~|wuxxwurrmmmmlkhijhikjkjhieffgefhgfgimpy~}}~~}~~|zlV`fke^Zd_\_`e_}wmlRoy|Pe{^dzWTlvrppqU_lWNis[]~}j}o]jqV\mY\sS[{rZXsV_|aT}xTg|\d_eivzxwmmlu{xzxvwxxyy}xolqyvka[YWTSSVZcgkkljihb^cijiihgeb```_]_^````^]]\\\[\[ZXYWXXWWVVVWWXUUUTTSSUVVVWVWXWVWXZZWWYXXYWZZYX[\[´yvsrqqooommkhhiijginoonnklhgfhdggggikpqs~~~~~~}~~|}WZalnj]Z]\\`aom]yj\{uXfur\Xvt{]~u~gL{wfRZly[h|_{[atXPsxmVWpymSkx[u~Ymz^qbeu\ssZtf]u]lZooygpuyxwuuutttuv{ymg`[bb[WTTTSVZ]`dilkljihecchihhgfdab_`^^]\^]]]^\\][\Z[[ZZYXXXWWWXWWVUTSTTTUUVVVUVVVVVVWVXYYWXXWYXZWZ\[[\|yuqpllmllnkligkkgjnquusrnnjggkhihhjjlpqsylZdisslc_^_`cdopVvqZTws}sZv]Zx}}c]kTQl}br{z}n_u_R~]K[tplOg|onmqwtuvo]z|_sep[wlzxtmotyxttsuusssswwyyppocY\YWTTTXZ_abehmknkjkljijihhggdcb`^]]\][[Z\[ZZ[[][Z[ZXZYXXWXXYWWUVVVVUUUUUWUUVVVWWXYWWXXWYZYYYZZ[Z[\\Ƚ~yvvrronmmppkhiilkjntxzvvvtpmjjkmkmmmpppqrsbagrxwqf[_dcfskn}gx_xnY}jzQXv}~~X\N]ow\st^^S]}l[Smqcazipnlk~gwtn|zo~n}egpd}tuktvvutsstsrqvttvy~yx{sf\[\XWZ^_bdefimmomloqrolkjhgeac__`_]]\\[\Y[ZZYYZZY[Z[ZXYWVVWXWVWVVUUUVUVVVUWVVWVWWXWYWYWXYXVYY[Z[\[[Ƹ~|}~}{wwstqnpprsoklljnmrwwyywvtsoonlkmonrqssrqtt~`emw~yufZbgfw}]n~zWZ}rjUtyhjmiNUxvXpqvcrfWWpgPfuatx}xywZhPofRgdQfcOrxZYjQzsV|]xurkpmhtvrrstsqrtusputttvw{}}~|xrf^__^_cceddekoopnpuwtrnmigcb`a_^_^_^]\[Z[[YZZZYXZXYYYVXWXXUWWWWVUTUUVTUVVVUVTWVWWVXVXVXYXWYY[[[Z\\\ÿµ~|}~~~zxuuusssqttsompnosvx|||wuwutrrponpoqtsuussrtyvclu}yg\inspyvms|hh~_VmZkxr\\|lwcZRiqte_sowrXmV]lTOjopXWr|iUhylTmjYqxXe}i[qg`obcvUzwawrxfoqpqssrrpstotusutstwvpqy}zwqeaccddefefinooporvwtqnnjfffddbccdba^][ZYXWWWWWXXXWXXXXTVWZWVVWVVWWWUWUWWWVXXVWWXXYXXYXYXXWYY[\[\\[¿¿ǽ|~~~{zyvvxwwyyxvuvsnqpty||vqrrpsqpooppqpsvwvurqtejt}|h]lx~[{]ovcNi|y\weQavpt`yhUbti[l{yl|k{ZejULkvkUSlzYa|q]fcwljy|e[[sz\nbmZztz}uolfnprsrrrqqttssqprrt{~unms{{{zldffefffgksvrprqquvurpomlhhghgfbb]\ZYVXWVVXVVUVVWUVWUVVVVVWWWVWVTVUUTVVVXXWWWWWWYWXYWXZXXXZZ[\[[\\ĺ{|vwvzz{{{{zxxxwusptzxrqrnmlpqossuttwxttrqn{}br{~keqs}rmwsezyflvVPoexul]SsqkZa|j{nv^R~o[Q^to~TZqs_g~zyzuiZxbimbzsyrjoprvutsovttrsqrrrsy}tswy|}}ujghfffilowyuspnputspolmjhigfb`\[ZZYWWWVVVWVWXVSVUUVUWTUTUTVWVWVVTVVVUUUVVVWXXWXZWYXYZXYY[Z[[\[\\\||zywyy|}y~zxzyvvutzzsqqomlpoqsstwvwutuqqnvtkyljji|x`p{hTy}y`ws]oqZcty{r}y}fOvbUNhm_\|e{|}||ulnjlfnpwpnquwurpvuvtsrrrrpqwxw||||~zlhhgikqutuuutrpvutrqmljhhfe_\\XZUWWXVWVWUUVXVSUVTWUVVWSVVTVUTVSSUWTSUUVWVWWWWVWXWZXXXYXZ[[Z\[\\\\Ľ~~}|~}{|}zzz{wszz~|sommjkortusvvxvutuqpkq~qp}oww}ecsaZ}|{\}y\Olw{cypqZ_h]NbiuWwp}olz}ozfgjnlmnoqqqttvussqrpoqrt~|z|~|||nihjnrvwvtuvvusuutqooljigf]VVVXXVVWWWVVWUXVWTVTTUUWSVVTVUTUTUSTUUVUUVTUWVVVVWXXWYYXZX[Z[[[YZ[\Z[]Ŀ¸~}~~~z|~||zzxx||upnommmruuuvvwuwtsornmvsxu{zv|xoaOi{vqt\`x|cx}{~xhTyeQUhr[l~u~n}zoVyfSp^Kcv[JwvTUlRv]{i~xykvdiijlmmvsssssprppqopt|{}~okmqwywtrpqstttsrsolliiijg]USSTUVWUUVWWWVWUVUTUVVVUUWWUWVSUTTSTTTSSVVVVUVVVXWWWXYXWWXZYY[\[\[\[\^Ƽ~~}}~~{|||~|vqonlopsttuxzxwvvtrspoqrwgdl|zfxxx_ssjnvYjcPPnnma|{b{dLouZGcdVO]lrTYn^Pn~`[{}Vct`^rg^kZqwWtz`wuojjjlrqrrsrpoqqqooosy~~pluz|zyusqnnqqqspqmjgfeffg^VSTSRTSTTWWWUWWVWUVUUUUVUUWWWSSTTTVWTURUUUVUWWWWWXYXWX[XYY[][ZZ\\\[[]]¸ǿ}~ztnmmnquwvxz|z{zyusqrqqzswz`z~|]sugwf\uYNans]~}t_^`LKvdjO[h{\Wj|lbmcteosd|_\~~Y}zUncme`|ezzsljooqppopqrpoqpsorv~qr}}{{{xutrpopnpnnnlhfedcc`XVUUUUTSTTUWWWWWUVWWWWWWWWWUUTTTTTVVTUUUVVVUWVWWWWWYXXXZY[ZZ[\[\\\\]^^Ƽ{xqopsvx{y~~}|}{zxuutttttyqepyhscZsrb[M`xwZhbdOxzfLXhyeLi|ajmjlynzyh{evfrwzpx|pg}chfekvi|{w}pnnooonnoqqqoqqrppt}vx}yyxwwvutsrqnmljjhhhgebb]YWWWVVUTSTSWVXYXYXXXWVWWWVVTUUUUUVWUUTUWUVVWWWWWWWYYWYZY\YZ[[\[\[^^]\ʿ}vqvvz||}}|zvwxvvtxt~{tzqaStetp[\xn~a\}{reh[NlliPbuka{dwxnywg}jSsZPzWNzkTZhRjbYt[~y`}dz}vduriix~uqttyrmnmoqqnnnnprqqpqrtz~{xxutttuttsrpnmjigfeddedb_\WWXWVUTUUUWXXXYXXXWXWWUUSTTUSUUTSVUUVUUVVUUWWWXXXYYYYYX[ZZZ\ZZ]\]]^żɼxtyz}}{zyzxuxyv|jz]jzzcvgWymbym^lseO[p}sVpfuzvmxXqnXZeTRt^OJkm^PfojR]ogRh{bYkgTmrVgmSzkRylYnk{~hzkqiu}shpw}qnnmoqpoomnpprsrqruuwvwvxvutvttuuuuuvwwvvuttvtsqrtsrv}zxvtsrtrrqoqnmmjigffc``baa_^\[ZYVVVVVWXYYZZYZYYYWTTUTUVVTTVTUVUUVVVVVWWWXXXXXYYYZZZZZ\[\[]\^]^ÿ·Ź|z}~|zy{{xx}yswqzekY{vhWmkUymjQesfcow{tdv_R{qTJptcHWhnWQegq}]cXn^t]~\^rq^~tV}l[l^ifWtWisvs{ijn{wrmrxsqlmnpppnmnnosrpoqtqpqssrqsrpqrpqqpoqtttqpqqprqpooppnsy~~}}}}~}|zyzwvvsqrponnmnkkjhigecdeb`_``a^_]^[Y[ZZZZZ[\\[[\YXTVUVVWTVTTUUVVUVVVTVWVWYWWWZXXZZZYYYY[\\\[\\^]½ƺĶ~~}}}}}}{}pxds~lbtXYm|vxha{laTldztylmOk|\M_~dWPijnRepk[}zgckryxzvznl{albs_hZqrpx{nmkgyzyvxvqpoqnononmnprrpppopprsprrqprpooqpoprssppqrqpspnooonov~~|~|zzyy{wssuustssponmkjkkjhhfeddbd`bb`^^\^^]]]^\\\]\[\\][YXVUVVUUUUUVVVTUUVWWVWWWWWWZWXXX[ZZ[Y[YZ[]\[\^^]_¿¿½½ǿ~~~|}|zp~a|kd~hT_rnh|~z]^tjvmboXP~kUGggkUZq{V{in}xxy}ps{`mvZjmSeVtVupetf}i{}}qw]k\yirqyeot}lyxwrnonnomlklpqqlnoponqrqstqpqoqrsrqnnrrsqqpoopnnnppqorz}||}zzyyyyuqrpqqpoopoookjjkihhdedbabb`b_`^^^^^]^\]\^]]]\\\YXUUVVVVVVUTVVWVVVVVVVVWWXWXWWYYZY[ZY[YZ][[[]ZZ\]\¿ƻ~~}{tzzdRgsrqrumWqquv__P]ndQSkvUn~pwzszk[ykRt`Ndt\Jev_K]o\Lpo`SliRer_Uq_UyfPvbVf`ty{~axik\mr}rsnry|unnnmlmmlmponnpqpnqqrtsrrrsrsrronorsspqrqoqpnmpssqqu~}}||y{yyyxxtonmnnnlmlmnllkkjhgheedba`a_`a_`^`^][^[\[[]\^[[YVWVUUUVVWVUVWWWWWXWVXWVWXXXYXXYZZ[[ZZZ[Z]\\]\^^^]_¿¿}}|xqzv]rd|z`Wpm{sdqWLvkiOZkt_px{u{Z{cQhcIVvaKNwn`sYVk|^WpbWoY]Wnk[[i~da_[t]ao[i_Z~bqz|mygjbkyk~z}srzyvnjjkjjjknnnnoqnnoqrssrpposssqooorsrqqrqpqpnlprtrorz~|{{yyyyyywrnmlllmlkkjkkkjljigfeedbcb`_]^^`__]]_^][[[\[Z[YXUVWVVUWTVVVVVUVWUVVXXWWXXXXYXYYY[Y[Z[\[[[]^]]^]]^]ƽ~}}xwonz[~~p[^|shg}hU]slbOkfy{~rdsp\ZhSSviZLgmwTQdugOay|jjmsquo|jvvs~tztwrlplbgt]j[p}l|szgumu`v{{vuvrjihiiiillkjlnomopsporrpqrssqnnoqrsoopppnmmlmqsronu}}|zxyyzxxywpnnlkkjjjkkkkiijlhgeeecad_]\[Z[\Z[ZYYXZXXVWWVXVWUUVUVVWVUVVVWXWWWVWXWXXXYWXYY[ZYZ[[Z\Z[]][]^]]]^_^Ĺ|zx|_z}|s]\tdz}xfq]StrvW[qi~qnvgO|vTPkv\J\speObtxVj|ffqbuzxnzsdocz[tx_~mcz[s~fqgboiruyuon|^oiil]|~{kli|spzvoigggghjlljlmllnqqnnoqonruvspnonorpopponnmmmnrrompwzxwxxxwwwunllkkjjiijkkihihihhfgcdb_\XUSSSSTWWUUUTVUSUVTTWUWVUVWVUTVVUWXWWXWVWWVYXWXYWWYYZ[[ZZ\[\[[[\]]^]]_^]}z|mx|}lhvuZvxhtgW\rqqVumw~bfP\x[KRrnlPaf|^Xys[}`}lutvwj~qV[}iTZdI[y[Js}YOxkM[}fMhkOctUZuZX}YXz`\movvowogvgszqqystquwqgdceghjmkhjlkloooppnmnrtvrnnmkmqpommnnmnkkmprpmlptuvvxvvvqnlkkkijiikkjhfgihgfgeddbaZURPORPRSSUUTVTUSUVVUVWVVWVVVUWTUWVWWWWWXYWXXWXWXYXZ[[ZZZ[\Z\\]\\]^\\^_]^Ƽ~}~j|x{k^Roti|~ZQotddrt_p[Lvp\JZcvfSjYxhyqslzfsxX\q_O{yZeQVnmZRhy`Ujz]\l}YdsmOcjYsx[sViv`a}`cmYmcYs_]mt{fwksri{|woruqhd``cgjhgjljjlopoopnnnrtrnnlmlopnlnonnmlklmqpkikquxxwvvokkjijijiijjjhghjhgffefdd_[XSOPRQRTSTUWVVUVVWWVVWVUTVVVVVVVVTXVXXWXWYXXYXYYZYZZZZZZ[[\ZZ[\^]]\^^_^^¿½ź~}}~}u|k{oitteaQnktY|xZcPYthWM_uWhnjlyzojlT|q^PkwTK\mbQQhnfz~Xp}Y~~Ytmly_zqiis{tqtdn_{c`m_vaextzepgdy|{{zti`]^bfffhkkkmpponmnnnprollkkkmpommnonlkkkmnmlikowwutplkjhhiiihikkjhhhiffffdecd_\\XRQRSTTSTSTVVWUUUWWVUVUVVTWUVTVWVWXWWWWVXYZYZY[YZZ\Z[[\Z[][\[\]^]]^]`^`ø~~}~~{}y|{|uh\wu[|raWyu}mcgUOtnlQVj|v[~e}|xzc{`mgScbIQnd^I^oVVkoXvvktv}{~z|y|~t{mylh|trrsww}k{kpqpf~i}yl~elawxm{xjfZ^dfehjklkorqnnononnmqoonmoqomnnnmlllkjlmlhgovvrqnnkjhhjhiklkighhhhffffedc`\^_]WTRSTTSVUWWUWWVWWVWWWWVWWVWVWWVXVWXWXXXWXXZZZ[[[\[]\[[^]^[\[]\\^^^`_^¿ú|}~}|{|}wiirrwl\aw|xxadWeesdQf|\nsplyg`iZS~rSRkj^N_h{eOn{\tdxsuyyd~oVmZ~p[alQi|aPwz[\ybMviMgpR\ZZ|_Rp^|qc~}|fxnyYywyznuwinwwmkccacdhjiknponnpmmmnponnnlloonnmnmlllkiifgfgjnoqusqnmkihijjjhhiifcdeccedca^]]\^XSSSTRSSSWVVVVVXVVWWXVVVWVUVUWWWXXWXWYWZYZ[ZZ[[[Z\ZZ[[]Z][]\_^^__`_aƾ~~~y{{}~}kyygai\k{ewx_p[Xsy^g|tgsngulO|sVL]ndRSjpwUdqcnuqmwqoxwUwmPNpkXOnkZPgjSWkrY]iiS\sqTbr`XylUorUl}[aqY_qcajXjx]u|a~fscwmdu|{vrrsxqlg`acbcjlknnqnnnlmllnnmlmlnnpnmmnljkihffgecfkswusrpmllkiihhijheccdaccddb`^][\[ZVSTUTUUUVUVUXWVUWVVUVVVWUVUWWWXYXYXXXYYZYY[[[\[^]]][Z]]\]^^_]`_^^_Ŀ»ƽ}{yxvy~tlycvuxqVk~{kfQZmvpV{e}{wX|iQZy`POlmuVbss`ct~]~v[ocMZy_MPzjQkqV\swW^{~Tb|uSwsVyga]zsm}ig|ptse^zXdvlkz[zjxgm^}dr}~zqywrrngebjmkjnpkjkjihjjkllllllnomkmmjjjjihggfegmqttqsoonmljhhgheecbaaacbcbcb`]][\[YVTUUTVVUVXWXWWVXWXXXWWVXWXXYYXYXXXYYZ[ZZ[[Z\]\[]^\\]\\\]^]]``_``ÿ¿Ľ{yww|}rsv~tp\izjZeu}b_sr}hgjVNuk_KVfzmX~f~oy}o|x^ehUSxbPIjmeLYar[Naros`xa|c{xk~{u|vwysp}|plu]z^tjjq`xit{g^m`kqy{}kjmcu{kx}yrtwnhklmlmjjhgfgegiihhiiiklnnkkkkjjihhfgggfjnssponnmlmkjifbbab`___```abbb`]]^\[ZWWWVVWXXWWXWXXXWYWWWXWXXXXWYYYYYXZZZZZZ[Z[^\]]\\\\]_]^]]_`_^_aƾxxwz{mkpou|g{brugUilwrYu\QaglXRj{^qyozrpwrYxdPhtVIdpiRSdjqRatdXxw^~grqwvdrz^s}sY~iX~rY\mSnpQY}\PqiNiuRZt^PtmRmlPq`tsw{egrbif~{~tx|min~qu{rpomkhdefggdcbeffddedfghkjihkkjghhhhghfegkpoponkmkkilhedca_^`^____``aba]^]Z]\ZZWWWWWXXXXWXWXXYXXYXYYYZYYZYZYZ[[[Z[][]]\_]]^]^\]_\^^^^`^``aſ}}{|pss~o_rr_YqhoagWWxooQautfnzyxwYz^P_t]NTrmbL]goRVpo[}~_wju~xqjwbUiz]JjzYMliXKsoVRlhVUkrY[mkTez]YtkUozUfyb]|nUrs_oncoXfa~qnq~ir]w}_~{p~rlu|stpibadgeddbbbcdda`cccdghihhighhhgffffedhkomkkkiihihecbbaab`a_```aabba`^[]]]^\YXXWXWZYVXXYZXXXXXXXXYYYZZZ[[\\\]]]\]\]\]]]]]\^___^``a_``_ſ{xl^uuda{ypjzeSclt`]~f|~gq\`aONnhdJWdv`Tl~Zncsqqr~qpqumX~ubNvvYahN]eiSThsUWitV[yXd~zWyraapvkk~rtjjm|_qnioWvj}x|d{tbo`~knx~|vmvvsxlc`afeddeecbddbaccaddhhedfhhhghgfggeaehmlkijhggedbddbcbbb``a`bbabaa_^]^\]]\[YXXYYXXXXYYWWWYYYZYZXYZZ[\\[\[\]]\]]]]^]]^^^`_^___^`a_aa~|zntrnwj}xeuqzf[yz]gvv}ikj^OygVJYdq\Mf}^omgqv~qpi}jQrt_P`|_HPlfVI_isijaxk_fod~c~s}{nvqpet^_ol[w_s|k|zdr^qjWqk{vhpjjstmxvywrqiabefceeecbedcdccdcdggdflmkjijihiifdgjkmjjihfecddccbcbcedbabacb`b``_]\^]]^^[\Y[XYWYWXYXXXZZYZZYZY[Z\\[\\]\]\^]]]]_^]^]_`^__`_``a`aĿøxvrmws^kzmf{r_~qy^nYPgmcON_r~V`vodivxuv`~qRiz]N_bOQeegMXi|aOhxzZnmtytwwvyoysrvhhnXt`XzbOnpPVr[KlkM`mWRsdNrsReYlbz{ylvhyandb^su{o}zimltr}srpebbbabec`bbabbab`aaccgikihijiigknnlklliihgeedcdbddddddbaaa`a`a_`a`]_\[[\[]]]]ZZZZXYYYZZ[YZ[[][[\\\[]\\_\^\^^]^a_^_`_``a``a`abaaaøyzloo`mpk{yhhywneTWsbkVTd{mXy}`w}tva|kV`zaTNvk[H`ggPTbxqUhuiiujm~{x|jYsdSmU[w]Jb~]I\maNdnhWbl[WprPcwdX{vWl|__o^~Zu|]qi^z[e`szorg~bk_ny`}q{|yqqqyrtla_`a``a`^__^]]^^`^beefeefgfeegkonmlkjjihcedddbdddbeedccaaa``_```^_^[]\][^]]]\[Z[[ZZZ[ZZY[[Z[[[Z\\]\\[_\_]__`^^_`__``__a`b`bba`¿ý|tznynszr`~o~gawvjWesjWOg~Zhnnrsb`fVNsiYFXdl\Ncq}Udwmgmur}y]xmWf`ecSRmdUQmkXSbn]Rg{gTo}gZ_ms]_znog|mrxjmcx^kkdq[nwYl}wmvgmf~br|j|vwwppga_^^^_`a`_^[]\_`bffdfgfeeeedchlmkijhihdedcdccddddebbbaaa```_`^_\^]][[[[[Z\Z[[ZZZZZZZYYZZZ[\\Z\\][\]\]^__]^_^``^`_```aaa_abacžz|}jrrayyuf`v|n|ofwqU^opb~luqvpVxsUKYkdWNZj~Y]wvdj}{s|su_ldWVgPKoiXIalj\uwUivuOjzVwq]ub~stystxzsn|es|m_rWuyc_tSd}o}y}j~auq`n^mrYth~z|jmhkklnsr{urrh_^_^_a`^^\^^]`deefghhffeedacfkljihjfeddeecdddcddcaa`a``__\^\\[\[[ZZYYXZYZZWYYZYZYYYZZZZZ[[[^][\\\]]]]`^`^a]`_```b`bababbba¿}mq}|idv}oZ{wtdyoqkcrcvruf}iW]w\NNiinOWg~w`j}|{}j~t_`eXP~jRH_jcNRgtgO]lxZ`wkycy~~hzpl{xsgrYxxcVsSfyZWgLjpOUvaLdjUZphNlpPiTk|Qkenwz~qcuqbtalcgdx}v{pzjsopwqojeaa_`_^_\]]^bcceegfefeeca_`begjjiggfedcbcdbbbcacdbaa`^ZYXYYWZXWXXZYXYYYYXY[YZZZZYZZ[Z\\\\\\\^]\\\]__`]`^`^__a^^abababaabd¿ļ{ytzmcy~zudwhYb|}i~lp~mtlihYUueYJW_qgSi~dw|zq~vg\oXLqp[JYmcOQcosS[n}hZxw\xmut~r[s{lQr~cOlrSP{kWLiiUVmlU[kdTas[UnlQehXux[qlb|[|Ypr^ukZs]_ahgryrcjfsdk]zu^~ov~|rmuqppofhjgfeeb_bbbbeefegefbabb``aeiifheebdcdedddcdedca``]ZVVTWWXYXXXZZYXXZY[YZYZZZ[Z[Z[[[\\]]^\\]^\^]`_^^```_a^`aac`cabbacccľ¹|{ymnx{tl[bty}kwfd{{}lzdP`m^MRct}Y_xxkvwdmfRowWKXjdWM`hxYVmzmZudtyoqi}taqs_^nhvXJmpWLmo\NbkbPdpyZ]tyXlt]{`sojeuso{leduak|`pga|]m[~syoucxsbnerdyh}orvrsoppokhtppnrjiifgeeedbaca_`_`dgjheeddbdddbcdeccba``__[XXVXWWYWYXZYZYZZYZYYYXZZYZ\[]\\[]]^]]\\]^]\^a^`a_`__aabbbabbccbae¿~}}oyyg|z{m_pzl|}ks_kyjvq`Stm^L[j}g^f{wyx_v]UYt^OM_eqRSbvvXqgo{upiu`^}k_QxpYLfq[J\te[arYYkuV[uZ`}[yfym}|szrw~|txfnkv\rp|`txoqdkcdu]wnfso{{rxngnlmqvouwpoqrmrnpvpuvvrmjghfc``c`^_`_`bfhfeddceededdeebbbaaa`_[XXWXXYZYYYYZXWYYZYYZYZ[[\[]]\]]]]\^]\]]^]^^__````a``aaabadcccade~|jvm]lq~d{ri^iznh~yvtccsnZR`u]vpxvrdZ}fTLji^JRapjTf{dmy~vnmyxd[~p^KtuXI[r]NRlhbM\bpZTj|znlj~exiy}os~|mqsY{kdpVzvWb|aQuoRbsWM}xSaZRqQtRzfnqw~zg^tgmh]uapa~{p}uzzcqrnwxpnrljolkmjpgeieffbefb_]`___^befeddecfdcedcccaaa_a__`\ZYVYXXXYYZZZZYYZZZZZZYZ[\[]\^]\]^]_]^^^_]__^___`_a_ac`bac_ccedf÷{~pxi`~yskYmtxatuw}|nSwqgTWiuaqvppbSzmVLYhc^L[p[_z}vfutnW{rcOlw[JUp\QNheqQPasjQk[k~nf|kvvsxlqvcc}jPk^LfqYRpnY^o^OmnU\jeXfreTgqV_wVowYf~dctcex^`u``}Ybherx}{dx^{cilgmZ|dpusztpslkxwprogpnhoikrhlkgmjgmeb`^^`]_^cddedccdcdeedeca`_____^^\ZXXXZZYZZZYZYZZ[ZY\[Z\]]\]\\\]^]]\_\^^_^____bbaaaa`bcabedceee¿Ļ}}}z}{zwxt}{|nYsvpYnq}|o]{bWRfuepvvfynVZtYJRifmTVivv[vgsrzpYk^ROpbNNafnNQbrqPnfgxigzruyi|fVcv^NftYI_k\NdjpTVgsXZwsUhx^YqUn~elx]b}jd|zo^[q\n^ip[sf^xWpa}|~tlz~cuklhrcqnqwqjnplvpntlpoijlfjidhdgkg``^^``^aefeeefefeeeecb`b``````^_\ZYZZZZZ[Z[ZZZZ[[[[[\\]^\]\]]\_]]^`_^__^_a^``a`abaabccdddfff¹}~zxwp}k|p`yi`Wpk}xbkeSVbum^tzjldQmlVKUbr^Vo|~bly}wsfrn^WzcRKdihQP_nrVh~ef|irxkvuZvn]X{h^T|p\djP[ghRYhsXUlxY_{fb}~ctue~fttm~lu~mtpv~r{xw}ztpsyooej{^ogel\|x]xt|{zjkhmijtnnpmjnigsgkngtpkrjiibgdaa`__^``ddedecfddeedabaa```__`__\[ZZZZZYZZZZZZ[Z[[[]^\\\]]]^`\]]_^]^^`_```````c_`aabbddeedeÿ}}{xyq{||m[`m}ukycuq^Uen|dcyyvskZ[pbSOaovUcw~kkrthZ|m`Mip[MXfefSXmfc~f{qwhyw[ql_RvhUMmn[LXmdRTmjiic^t~_c_q_shqsunzsiwgxpbv^ph[zmXqcYuQo]fmUW}g|xuz{k|]xy^tkeh[zib{b|xj~v{yr}joogiqmprhmmfjhhjgdndjmhhf``a`^^^cfegdeedeecbbac```a_^_``^[[[[\Z\[[\][[\\\^]^]]]]^___^_``_```_a`a``aaacbbbbdddeeded¾Ľ~|y{}y}uiujxyrfr[XfnsWsp|uvlStm]LUavkXszjmn~phRusZJUmc_L[h~`^u{~bzfunys_cpYOqfPMmo_KTed`M`jzYRjylUq|}qepyeo{plpr]kra_yhTp{[ZxcMrmP^w`QjrVYndPjyhWqs[`yg]rjRqtXfpUlyZb~Ydkrr|~lcwcgavflfm]plgwmy{usufilcfgbshhrknkdke`dkdjgdb]]]`cbedfeededaaaa`aa_````_]_^\\\\[[[[\[[[]]]]]^^]__`_`___````aa``b`abbaacbbcefdeddfe¸z|w{|vs|}qh^boriWo~qyxd^u_SP_qz\dz|rmdylU]sYNRgcqUWgvz]slpz}pllriSqiTLgn^MOcd`O_j}aUmvuVt_izniy~jubh{p^hhShsUMjwYOan_Rjq[ZimV_pcTiv[\yvVlzldb|{]]gq~`~]yfrvasg]uZo}Wt}hp~uul{eygpsahnjlrhwsqvsfojghcdmgflhjidheaggb^]^_adeedeeecabaa`a```_`____`_]\\Z\[\[\\]]]]]]^^_^]_``_`^`_a__a`aaaaa`aabcddeddedfeex|{|~w{yznggowcfwzq}s]p{aQ[evjXu~mlc{ncMqmTJYcpaTn}jl}nwypmUyq]O\vZMNda_NZeycRntwXseix}riozsnbwn\tpn[PknYNjpYN`fcPYiwZXkyZfxs]regya~gsh{~y||yuncu_ypao]hqXopWxgku~xwym{ktscifdfidrjmqtntignbdf`gghhdcge`]^^bdaddcddba`a````_````^^_`^^\\[Z\\\\\\]]]^^__^`_`__``aa`a_baabb`bbaecacccfdeceeeþ}}|~t|~vh{uco}w{}x_wlWRkqcj~~rqez|fVYoaPM`kvSexomrzjyoZf~\OUna^LUdubOfsvZnkfx|uipyxr[ywnXgcUUtdQRooZ`iS]kkU\mxUat|Yoathwruyyswntzgvhdwbx^]mt_|`lyxkf~dsicsbmccuaqij~esttpvkstaqedff^nifpkmnckdadcdjdcb_ba^`bcddddbcaba`````_^___^]_^][]Z[\][\^]^]_]]^^__`^_a``^aaaba`abdcdcbdfeeffhfeghh¼sx}}xokz{|regZVeijWvpusrdRsf[NT^qkTu~`wusw^uf]UriWMbfoWSdnw\d}n_vzueqqvp[uvlXhiUSocQNgqbQQbfaQbcqs[ky{\{]w}fyrnxxd}qe~xcwj\|kZh}]XwpTbcQqv\X|hPlmV^ukWnlUnuZh{XkYuhs{nlli~enekgecar`qkluomoserehgb`fehklkkfhabigdc`^^`adcedcc``b`````_`______^`_]\\\]\]^^^_^_``^_``````a`acbccbcdbcbceeeefffffgffg¿ÿ~y{w}{y|}xt}eZdpyhYs}uots_btaQP]n}^f~tjt{oa[ybVMmmiUScmsYavl_{|xbrwtnZswlZ_~gUQkfTNincSQ`fiS]heXq{u]~|dxzqo}vdx~u^ogZpr\VvgT^s[QolXWieV]khTcxiTmc\}{Tlh`~V}cesY]tw\qq_mcjv]ny^ud{|l}r{{||rmvtfxcgcm\ei`selrpipdid`cebjkggabffc_`^`acecaaa``_`_```__^^]^^^]^]\^]]^_^_`_b_^_`]]^]_b_bbaabbcbdeacccdddffeeffgfgh}tqzx}t~jctq|aesptxpYvu\Q]ewlWylvmslSjpQL\ed^SdqlZx{zdr~npcvzo`_lYPihUM`jdUN]fjT[e|hXtxx\zfpyurtyw`uwkWrw]RolVQoq[RdgbUbsbVisY[wpSh{f_|^ogq|kxzo~w|tojj[y[opbphbl\rlYvg^erthuuvwtvxhwgihcdbc_paiiihkaha_heejb`ehb_^^cdcdba`a^_`````_^____]]]^^]^^`_^^^```_]___daa`a``badbadcccdeeddfgffefgefgev~~}~rr{zfvwx~yjZugVWjp{\ouqo}iZSqbQL`hoS^qxq`ymqrz|sedmbSolXO[keVP]dnS[kzmWux{cwrquvsmvup_rjWt|gjXSnhVSkl\QbhdR]muWaquXqkcy~crvhynszqphrsdngu]hiw_jktu}qgeux]sZsfctdh_jeam\vggsfsqtkxnjncgdc`kclkgjcceafecbed_a`cacb`aa```a``^__^^`^^^^`^_^````__^``_a__aa_`a`bdbcbbcbeccbcbccefgefgffhgfÿ~~zz{|z}wp{}lnk\\fsl^|nywnjToo[KR`iiOi}}_rx~trmrpkXsr[O`qfRUeblWZj}oYtxcrlop{shqwl\|qcPgw[QZs_MTof_jgP`nlR`vsWjvtZux`s}wnvvqr~shxv^|yfdlU~aUwPf[L|wO^y_RxvV]v]RwjNrrSwtUzyYxlzo}s~u}synqq{czmbqaldfbce_odnrkosnmkdgd_jfgjfbdddfdef__``bbaaa`aa_``_`_`__^]^\]]^__a^____^_^_`__`a`aabbdcbcbdbcadbeedeegfffefgeg¿w|v{l}wj_qtufzxup^at_QObex\Xvzrbpz}ph]{pfZkvgXVgkqW\nn]||dqpuq|ulgviWtm]Sfx[NWoaTNehgQUdodPcky{s\v{sdypit}tomsdvzl]v^d{gVuuXZveUcs\QqqbSnv\[rvUe{wVtfeZxbak^xpazker]hu[ivVp|[myY}x[}o_rpwn{vvqwykxfnn]lcgah^lkeooikcce`dkcccecbdc_`^a`aaa``_`___^^_^^_]^^]^___^```_`a^````a```cbbdabadaddcccceedffffgffffggÿ}y|z~|q{lgvzo|}{ynZyo^R\htk[v}yfmm{qlTit^QXlgaXdnr]t|juprrqqhtkRlr\O`y`OTj`YP_gpYRalnSet}]^tymezyyvnh}wq]|{lYtseUur[VqgQYudRfl^ShmaWglbVnz\i[}zijlomuzutg\|_oxbnm`paepaghZrl]pZmm\tamscskqnqkkr`kbgbe_mginhddaahdacdaif``__``a`b````````_^^^]]^___^^^`_``a``_`aaaabbabacddbebecbeefceefeggehgggj¿¿{{~xzz~{ntr~xm`{k[^kw{_k~|rpny}jeWrdSOefpX^q{|g~yu}wthun[st_W^ubRPea]O[em_R`mqXctbfwzocv|fpp{qnby{ytcWvmYWxfPVmeSVoh\SbkaXhx][owZdw^x~omgr~}nywgwvrx|{wpd{b}e|v]qcramicfci^g_`s]mjiopimmakcbcbgkgfg^bic^aced__^_``_``a`__^^__]^^^_`_^_^_^^_a_bbb`ba`aababcbbccdccedddffgffffgffgfghf|yq{{}w}}zmy~pbbt|msqlrgWqnZOUaijToiw~zsz|r^swdY]xdVViegTZfweQamu\dw}k_uzscqz~ojf{qoYon\ZwiVSpn`aP[kdRUhlYScqfTi{s]t}ogftfz|ouwtnzoap_rXp_VqVh^RwpVg~__d]pXt\n~orzw~wq{u~sxkznkzanfekbd]o`kghlkinecaaehghe_dga_dida`^^^a`__^```__^`^_^`_^___^a`]_`_aaabaacbacabaacddcddcfefgeffeffghiefggÿuv|xwyswhsvt}m`eseWVhmy`Zu}zk{xseth]po[ZmloX\mylXktycj}ncuxwhpv}sm`wtn[g}iXXueQPnpUN[m_STfhmvaWhvf[ogc{~kgtnxrwwvkw}wcxqY|rca}dNpzYS{tVWviSbtiRiua[q{Z[qkWsz\lr\ls^kjUrsXkrVy}ZrxZx{Zyw]|yfyitzivsxvtvm{ikncjccdg_iajjeidacfdfd`bccde```^^__```_``_^__^_``````_____^``bca`ac```bbccbccccddcgeddfeffgfeefeghf¿Ŀ}}xyz{yw~y}wuw|zhyjZen}qa}mto~upas}cZeupi[evr_p{~hishx{}hrrto]rwlYazhWTnhTPgo[RXgeZMdfpUWdohZnz}}gj}~hqprppti{rb}rgfp\mq_XtkSXpdV]lgS^sqS_{VomXds~`nlagjpminZ}vZsoark]nadp`cj[hl`mcds^kg^ydpogunpnxlohfhbagdejggdbcdedbcacef```______`_```__`_``a``^^`_____abaabaabbbadbbcabcbeedfeefffffefefffghg{|ywu{vuz{{o~}tr{ogzm|yzp~jfYug[Xnszdjygz|r|pupzvcuzl_`~jZSlkURfobRTccbP[du\VgtqYpy_mz{piz|wmorwofyg_xi`]{dQ]q_Tcp`RdjbVgleScshYrij`fuwqw}}{z~vyy|{||rhd_~{]}z^xu]yraxeou_jccg`e_lbbncslpnpgnahd`egdidadgfcaccfaa`^_^`__]_^^__`_```___`_`__`a`abbaadbdcddcdcbdaeedefffdhgeefefffgfggg¿y~wmu}zs}v}{y||ou|v~xzphZtmcTYetj\wuxvy~zfyzlbbj_Zoi^Tcnj\TbdkV_ivcSmqu[p{cqy~nft}~lpnsu\xzq]cv`U]v_P]l^SYjlYVdn\Xly[^swYlr_x}pj~tvseqh_vnVbcn[Vvfwintkxoyuwr~nypw|qw}pwps~musi|emn`occchchfgokkoghfcdedgcadfeabfc_a`___^_^____`_`_````a__c`_`ababbbddcdacddbdeeeeeeffgffggfgfgggghhhgg¿}~py|~sz}t~|{}}stshssn^Xju~fhz~wsw}qm`nqc_ymeWdppe]inw`bnpXsw~dvipw}tjlurmb|pnYo|hZ_ub\UqlaZO^ibUXhqXWdtbXo{i`tzfk~dr{vjryodyvkcijxXv]UlObaMkwUU|qY`vaZ|tWlqZmw[et]^fW}iZrXxp[}r\yoY~qdwbowdsrnsnrkumhtboaeceajalkhjgbbeefbbegabfbc`^______^`___``a`a]`_`^___caaba`dbbabbcdeedeeegggggefgggggggggghhggy}v}{{~}xvt{|xqumhzslpxvh|ptjysfpkysi_nrvbotgi|{gh{nmx{qrqwp^{snXizdV[saQOljWO]g`XTffns\Vhv`]t|bdwwaky~jjp{pil~v^pxjVtv^TpkT]tdQi{aRqycTpwdVs]`z]v}Zwdtwcwb^uy^k{`ip]rp]jk\ol[lf\ni`m`fp]je_u`kmdsmllrkljiibcgdihijebccdecadecbab___`_`^_^^````^`_``__a__`cbbbaacbccedbdecdeeffggfggegfggfghhgggggg¿w|vnxxsu~rxvv{vx}qnw|zj}lbf~mhisv~lxou|wuvtn~t_zthYdyeUXocTNhh[OUcg^Q_gsWVdqjXlvzx`juvckvzhkjyoed~tc^ugSev^RjlVUoiWUggZZic^r_i]yhnosx|yijhvipogncrd}kflivbmtamcgjcgancdlapfijngjbfc_iegidbdedcaacb_b_`^^`^]^``_``_`_````a````a_cadbbddecceededddgffgfgeggeghggfggggggg¾ú|vs~~ozyo||~y}r|vwy~|~y}sigwlbjvpxw{tw`w{j_g}hYXqi]S`kdWS`fhS[ht[XfqlYnyw[htvjft|xvnflwo]b{l[^tbVau^R^l`R`miU_fjR]unTiulayvvit|zzyrgfpzxo|llx{z{{vwu|s~vuvt|rwykzqo{enmdncfchahcfkhhkegbceegfd`eecbccbdb`_`_^`aa_`_``_``b`_^````bcadbccdfeeddceecdegeffeggghffhihhihhhhhi~sxw}|ty~stxo}v{~|u~tn|zsowvrr{scz}kcnq_arlgZbns`XeotZ\lxdYnrq[nywakqwmfiuylg`wokZqsh_TdoZQdnYQ]gaV[hp^Vcq^]r|]ixx`xtgv}ppxrx^n\xZd~\Pz~\[{fVnz]dya`fX{o[x{ao{_rji~kjnh}idjmvduvlwnusrsmxiomdobedcbgfjhdib`ffegaaddaab`c_^_]___ab```_aaa````a`acdaacdceddddccedceffgeefgdgggffhghghhhhiiix{}|{~xnw{oq|}|wp{{tz{y}tmxjcqsdcsw}efsxaoy}ffym_w{xas|yejowpjfpynb_tmdRfs]RZoaTUme_^U^cdS[iqZZitabw}jhx{bj}|ktzxsoz~v`yvp_cfeWrYU|oT]nZYqnWgyzZezeZty^nt]hy_aragtfdo]gs_`o_cub^n_^odaj]ilam`jubpmiulonrhpdhecbecjhffaadfeca`cc_^ab____``````a```a``````_a``bccbeedfdcedceddfhhhgffffhghgggggihhhgi¿»¿{wvpvzx}vn}}}|wyyuywwmjwkpzutbgsyhq}prl~lxnqpywnhoypdWqjaSgrZPZl^PPii]PYddYS_guuZ^ot_h{|chvzdosool|vij}x`ovmYps\ZoeW]iRcslU\vvZfwrYnt]zdlesmee{njvh|_uu^yz[lt^o{]lv`kx`ko_skakcjbfcco`lflohjngiedeecifee`beeddaaacca^`_`aa````_`_b`ba`baa_cbccbcbecceeeeegdffdfeeffffgfggffhggghhhhhzxnrx}~z~qss~~~wpv{~vjwnz}pjxtnjx|pu{}|s}pjul\rq`Vit^UYkbVReceTV`faQZivX\ktjavxxw^puwhlt|slhyqh_{p`awf[er\Rjk[Tih`Tag_TlsVvecd|zjsrt}xs~ytzsxwy|}s~o~}pg{g|jwzhwnuvhxrjufsm`mbjddbfiajflihkgedadffecbddeabacdc`_`````````_``_`a_aac``bb`accdccdbcddfffedfdffgfgeheghggfhggihgi¿|u|s|vsl{yvtqnv|vu~{wshtytnuzt{}s|ri|pgvxhah~i\\li]WcjfUV`gjU_iw^bqsm[qzs]nrxjoq|xuqakvn^fx`X_q]T^p`T^j_S_igT_hmV]rsVgsm[umjxxy{eufzblsWwx]`j^~t\y]mmkshwgxfxti|xfxtdxxisqkwnnooqlsepjck`hbdcgbhghjfec`ceceb`cdb```a`a``b_```_aa^```c``bcabaacdabcccbbdceffefegdefeeffggggehhhhhhhgg»»}|x~ztxsopwrkuzo~s{wyxxym~mvgmymhzzh_o}nbdrpn`bovj\hps[eryhhvur_s|ydlnxkjfvxqbewme[tmdYQbkWRbg^PWceZVcp_Ufq]_rw[kuu^p{renvojzvkhjr\w~`ZvS^|cRe{gTgm^\piYmkYnp`dr\cz`[t^_xdWrhZui[qgYql\mdaucjk`uijnkojnfoghfcce`hchhdeb`bcccabaabab_```````ab_```^a`````cbcb`cecccbcddafddedeegfffffffghegfdheghggh¾ysku{wlx~vyzout}ssxrou{}}}{kogg|sjcoxukdqv|hhsxgw|kowm|{wfv{zkrjyqocpyp`^tieTnnZR_k[PWk`]cSZdiZZiu^XnreavxdetubluxjlrvndpyoZopcY~Y]eRl\Tpp`XjseTfygQncb~Zthkq_|\ov\i}aeq`gtabo_eue`obaof`pdgnagbkcehaocjjjjihjgcdcbebifbd``debc`aadcca```a_``^`a`ab_a`bc`abcaebaabddcddeeffgfeheefeegghfgfhgigihhhhi¿xr}{l|}}{pzov~{~sk||lv~|zzwylqqy}ml~}xegptzinyn~qysrzzl~wrcn{oc]si`XimXR^g]RSe`_QX_iWVcmou]apt`fyv`jpvhlkxpigvl`cwgWhn]TjnXUkdUXxr[Zjp^[r\by~_ueupq~qt}{on~k{o{nspqrq}mppmzmrxerjeo_gch`hbdjaifiigdgbbdbgfccaaec`_db`aba````ab_`_`aa_a````cabcaaedededefefdffffegefegffghhfhhgigghgiiºzu||ttwm~v}wpxqiy~~}~nwrgg{wty~qqmsz}|~l}qqvj^uk\Vin]S^ibVUadeSW`k`RamnXekqafuwemaijthfgxnd\si^[sfX]m^Qan[Uad_S`gfT]gjVf|Zvrikr~upkn|e~i~qmvcxk~m~{r}pyzou}qvwot{prumvqpppufrhlldhcgaeaibhgffdcbbcfedb`acbaaa`aa`a`````__a_a`ba````b`acacacbdddffdfffefhgffffghghghfhhgfhihhh}prr|uzxxoxxvyyw}~n~qj{xkps{ugr{|{vzy~z|vwptvleztgbpyk_^jeaU_fp[XengUcpqZgorccrvg_iopgfgxksk^\peU\s_Q[l`RXkfWXbgXVfoY\jsYasu]msrks{{r}}ahZoX\hRhtXZ{gSqnZdz^ZyeXykWrjXvoWnp[or\mo[jt_km]ofdnfsmllooknenfecdaeagfegbacbfdd`ba`ccc`b````ab``aaa`a`aa``b`bacbececddbfecefeeedfefeghfggfhhhhghghhhig}xllz~t{so~{~q{wzvxv~wr{omxw~jpszo~~v{sg}xpfrqipzlgs{sifsttcjp}j]ksp^lttalutjarwofgkqff_spfYfm_VboZa\P[h^R[ffWV_haW`tfYlrbbvx_rwxesyxmluul}d}gck[quYVyoYZqm[[pvd\puZg|d`vq[kwbiraesbdoain`bk_cnabjbclfajcgkcg_keekepgkknjlfgfaceaeefebab_eccbabbbbbbaaaa_baa`__`baa``aabbdaccbdddbedefffeefgeeehfffehgggghgghfihjy{vr{~xtuuxsv|{~xryl~uzy}qtnwonzwh`fvnfenuznjvxknz{rkylowypgqywjmgvmj\prgXcm_VZn_RSdaUO`c`]k\T`m`Xlvf]otocwzihswnpqznfpvmamynYlkdV{YYxiSdulVbolVi|yZrx^~tna}pq~eiuoppjmine{qbzrfvpdxueuohuekiejafbj_jeilfkijifeecbfddebccbeecbeaadea`baacbcbbb`bb```bacdcbecdcdfefefefdeeefefgggfhgggehfigghighh|uwo{y~x|v|zy~|}uyu}porjcy{kclutljrv{ganvyin}|osxy~uteyqk]nseZ`pbXXmbVPabZRVbe\QYahSZdsfsfgsuckvygloxokcxpg^qk[]tbXcjXTii\VccbUcwnTe{k[xcjb{kwuy~trxs~yvxq}o}xs{}qxus~tmwunzxptroxwotrnwlrnlsfmejfdcgecfdiehiffccceefdbbbbfebccbcabaabcacab````abacabccaccadffeeffegefeggfefggfgfffgghfhgghiii}tsxvs}zu~ts~|~~zoymihvmdltsjbpv}iivyjynr}}}ozzy{~~yzmtlb`sgZ[og_V`edYXaehSYbl_\itjYkop_owuctjjgtmfcwne]og\WnbS[k`R_gcX_dfV`jpX]j~`tcuplzsqze~lZzad}jYxxbi{g^}tXrw`mdkzgn~ihzli|jgwjhzigugnoepjpmmiphhjcjbdddcfehiegd`fddecabeddcdfdbbbcbabababbc``adddadbdcdfdfefgdgfgffeggfghhhffifhiighiihhjhj}}nu}~zx||uty{wt|hduplbhsv}hhs}xhvpwxw|sso|zvmozuk~xx~wzzkgstn_bkjhYbmn[\gsf]mts\lpsbktvldeqomentjqh\ZobV^q`SZfbYWbk^Tbk^Viu^_mq\hut\ntq}uuwjhto^y|][xmV\{mXcrgXnvcgri^qr_io^hq_jo]kq^do^eq`encgn`emajjakcmiglhljjhmfjdgdddedggffbaebcecbdddefdbbbbccabedbaaabbeaeeeedcfdfffggfgggffhhfihggggjgihhhijijhiikkÿy|{u~x~wxwq{nuzhov{nj{mu~woz~wzsvvhw}pgewtgbn|lej{zyw{w{yhmujdrxtcswvdnuuhkoyqkfmridbvlgWigbWcnZ_^V\gbWYem_X`jfWfslYlsectvdimpggkulbnvak]s[beSnv_RqsdVhroVmoZq}eoye{~ioreyrbzvbso`uranm_nsbmoblpbnkenefdhefecmcihjihgjdecdcceffedaceedebcdccbccabbbcaaaaacadbdeeeeeecgefegfhgggfgfffhghhhhhghhiijgilhjiikkzx}yzwz}mv~zrn|~pxxyto|xthr~qhexneetri_cpnj_loznfu}}|qnyy~uqsyxqhjuljZrmdVdk]U\l]PWe]VR_cb]mbUcm`\nte^oqhcksjffrlgctqb`pgWfp^UgvZXzpYZtkY^ps]cq|_ja~c{mk~~rn{yyu}ozk{k}xg~{mywlzwixqkxjmmgnchafcg`hegghigfhbddcdecddbdcdcdcdedbbcdcbaaaaaaa`abccdbdcdfedgfffgfggfgghhggghhihghighhhjiikikkkzq|}tzyyvz|{xq}yzvvwsg{|qdevkd^qrlcgmqjbjqzeeqyzlvxo|u~}rh{qocrqcX^o]VVkaVTab]QZac[R]bdT^kofsc`nqcfjqihboliZomb[lgZ\n`V_f[Tee`U[pnWd{yXms]jygq}xuzroz{n~r}xrvpxpvt~vn{tq~slwsoxpmunqropmqgnglfgeebfcfefhgegcebbeededbdebcfecbbabcbccbababebaaedecdffgfefgggffhfghgegghghghiiihhiijkjjjkkk}u||wq}zq{{{}|n~rgpzkbdwnl`flqmeksnjxzwgy}~or|~u}{~yw~pgrnbfth__pg_V_ccYV_ifV^clZZkpd\imj^jrnbpme]nl`]pi^WhcVVj`VXe_XVdh]Xbl]ZiqZefgxtv|~q}}azo\zbb{i^sw^bwg[pw_eybb|faxkd}lbvkgzicsgcufeoaiqenilkiknhkhhhdeebdcffefecbccdfccdafddacbbb`bccbc`aaabbbdeebefefegfgfgfhfgghgfghghhhhhghhhiihijjkkklk¿|~|u}r{||}ms~qlm{upentvidlwklxz}m}ovv}vtow~vug}zxkpzqj{vwyqo{sffqrscckni`fmo[`hob_mqg_jll\hinbd`jjg^hnfmfYXj_U\j^WWca]T`ifW`mfZmsbbqragwtenzx~pye}dlk\t{\Yrm[Zxq\_mk\hrl^lpaguqali`pl_nfbpc`leclf`ifalg_heekagahdghfkhhihhhffcbececfecdbceedcbcdcbacb`a`abb`aacaabcecddcfffefedggffffhgfgghhhhhhjihgijjjjijjmkkk¿|}zz{|{wvrioqypkpow~tl|~oxu}ywswvsfzrmbnyjdatqd_oxpelyyyrxy|meowrelv~hirvrfvwpdlmqbggqkg[ile[]oe]WebXVffX__WXab[W`lgVejiZlrk_mshfpthikrjgjvm^vza{j[{oZa}eVltiYftmVfswWkp\u}co~f{kmzgxyd{|aquboxbksdowdnrdoremmcogegbfbdedbicjffgggedbbbddeecebbcdccddbbbcaaaa`aabaabaddcdcdbecegeeegefggfghfhhfhggjhhhghhiihikjkkkjk~|~~ywxv~rqz|~lq||prtxp{wphzvpenzibdqh_blnk`_hll`dmwhcpzsvpn|{rmx~{ktuyrniuslbeog^[le[TcfWP\iZRTb^YS\`c]kcXelf[psg^mqjcjrlicpkj^qma`ncYamYTpv^Sqp_Znp`Zk|_\t|bibzyfsq~mwqxsu|ty|oy}mwxjzzgtuiuwjtsiqrkoojqijmhmbg`ebeagbgdhgefceabccdeedbcddeccbbdb```aab```b`addddeedeeefffggfgdfhfggghhhghghihihjiihkijkkkkj}}r~}qkqx}s{~|tr}|yurm`pvfaetoe`lonc`hlk`fnvgbptuepyzjkz}w~rwu|wtktzslhupe`ol^Y`g[T]j^WU_`]SX]c^S`eiXgko`peakphhfrni]mki]kkb[jaX\l_T]e]T]dbUbluZ_yz^l~offtk{~ro~~ul~qktfsodxudqjgzoe|pdwqjysfsogsphrkcrjfoginjjjkgkgldebdbcbecefeebdbaedddbaaacc`aabcb`c`baabbabdbcccccdfefcfefeeggghghgihghgghhhhhhiijjjljkjkllzz~xpwy~sm|x~}{}yormqvj``nnqdbjqqciqyhfqrobpwwfjrwrkqrzprl{zqu~rkgvneappe`frd\`kf`[^adWX_idV_el]ajoc]lnldinncqke^lh_XlfYVfaWVeaYW``WYag]Wbk_\jnYpb~yjqowzntvevj\st_^|kWaw_Ytr__ufZoq_er`awb_oc_ud]nc_rd_mb^ncci^iiaibiegfggheidedbccbfedfddbbcaed`acbbaabba`a`a`a`ab`bbdceeddbffeffehgehfghhgghghhghghhiijijlkllkkjkk~y}wz|~|o~smwvmmyyxiloupaju{jivyvisyxjrlvqmhovpmestpagxmdbtskfptfagnhb_kkpacgof_ilo_ejlb_lpfajllaggqgf_lifXclahbYXe]UXeaZT_a^T\hfW`jdXipbbjm`fnmcx~wpzhzi]lWjx_Vqs]Xnk^]que\lp_dru_kqgdpvbmr`ls`focfnagl`foadl`ejbgg`fbc`g`dcdfdffffbfa`cbddeecebcbccdbaccdcbaa``a``aac`aaecddeefeeeefedfhegfghfhghhhghghhhiiijjikkkkjlmk}~s{qxtlm|xtmrvwluqw{zpkvzzkpnvwojnyri`olf^hte^bpka^fnf__nlngjktdbinmclszfmuvmhsuqeklpdgfqij^jie\[kb[Yf_VRdbW[]YU]a]T^idWcigZhmf_imebjojd`lh^anfakoYr~aXvhW_veVgmkWdrt[dyw]vvkhui}}pn}h|{k{~iuzgr{inwiowhorepsfnlfmifgbf`cbcacbebfecebcc`caeebbaacabcbbdcbba```abb`badcceddffdbfggfffefggfgghehhhghihhjjiiijjjlkkjlkkkw~wolynlsu{pnw{rt}xwxv{uvjt{tjaqrgamtc_bld__fhj_agjo`divkaosxgnuxljsuons{wntswnogspkbcjb\ZmcYTbaVT\g^TV^^[T[bc[ibWeibZilb]hkgccljf\igb[leW\g]SahYVgsaYkpgXfpdYldcxdrbyzlvx|rxzvxvzxs|us}tszru{ootonwolsmosmlllnjjihjdhbebcbabbbddeddccbbdddcbbabbacbaab`ab`aab`cbadcddbefgdeeefffghfhggggigfhkhhhhhiiijijkjkkkjkkksowyynjty}pu{yuwzypkyrjcqsh]akhd_gjmb]fji`envjcqrvhtyzmmowtmsuxonhuqscsxqihqga^li[YacYTZc]VR]_`UU^i`U^fdXdlh^kb^dicd_jgbYdg^VfdVVf_SZh^U[a_VY`f]_l{^f{_ushlzp{wpzvg}nh~rap{kbwqbn|ievkbyqdsmdsremqerrdlkaoidnghoekiigieidf`eaab`deeedfaabadcbaabdbba`abaaaabbabbbdeecefedeeeeeeefdffggfgihhhhgihhiihiimkkkjkkjjlll}|oqwtn|~w~z{wzs}njnsoibklre^gmqefoviersndpuvmnqwrqomxnmaspnfjuia^oha`omd`djd[]gcaTY^dZW_gbS]diZ_jka\hheaajiblf`WfaZVf]TUc^UT`aZS[aZV_g`Yai`\knftkm~wyr~urwcsm_nt]]|mYfre[kle_oh^hoe`od`og_ih`lh]ih]kf`hd_ic_gadf`gchefeggefecdccbadddeddcbbbdbbb`cdaccc``aaaabacdcddfedfeedddeecffgffgggghhhihiihhijjihjkkkkkjkkklw~zy{~wv}zuusx{zr|y}lmswwgsvzojsuthruwlngsnmjiuojanof^fs`[amh^\hibY]fc`]dfm^^eld]fjl[ahi]`ikb^dig^bekhb]ed_VbeXd\TUb[RUa^[U]abV_fhWaic\lmdcjlefkowvy}j|wc|sca}fYeu_YqpcXhmh]kwg_nw`buv\gui`sv`isahwidrhcsfalfameckbclafibhabbccd`dcdddfdddecbcbcddebcabbcbbacaadbb`aabadacadeebeddeedfdegfffgghghhggfgheiiihgihkikjljkjkiklky|zn|}smoxslpvxxyyqt{zsouyzoqgrrldhtjd^mhd^cmb\`kga\cgla\gji\bgna\gkg^hqqbgnoielnidehi`a]ihbYdf`Y[h^UU`\RVa_ZZ_ZT[b]U_heWejh[ini`emdeclge^jfa`lq^e{fXqsY\rhX_njZ`hr^cpz^fuwarnh{{fvwgw{mp}xhuyhu{lpvknxilrjjsilofjofijckfeedf`d`ab_baeefedfbceaecbc`abbbcbbadbca`a`bbaabaddedfdceecdddgdgggghhhgggghihhihhijjjkkjkjkjkkjllrv~rlp{tojlqxskw||~uunxrsikvjf`ml_]fma\^jeb[adib_dgl_`jsi`lnn_jopcgmohhirojijnjf^klcY`g_YZg\VRa`VT\c[TW]]YTZ`e[haYeh`\ijc_bgef]hkfZfe^YhbWZd[W_gaUdndWcnoYetk[pfhz|au{dt|rjxvrpzrls~thytmlzsgwqkuvjotjntkfmikofjlehkgjfihfggfcfcd`ba_abddefedbccabccca`bbdaaabbabaaaaabbdeeeddedeeeefecfeffihffhghhggghhiikjhjjliijijjilklÿwpuuyojuw{lqx{tr}zqx|pherlb_ioe]_hfc^dfk`\cij`bjpg`mnmahrrggnqkeilngidpjj^iog_aka]\geWV^`XRZa^XT[]`UY\f^X^dcXdig]ib`_hcb^hgcXcb[XacVVb\VVe]XY__[Y_{a[ky`f}|^v}nkgr{~nnx}teuyrawwhgvk`jxf^pl^ftc_siaql^jn`kp`ek`gk_gf^fd^fachafafdeecbebcbbbabddefccdbbcccbccdecbac`aca`babbcdcdeedcddffdeffhghefghhhhhhhijgihhhijjkiijiiklkkn}uvyxqoutzsxoyzzxvjhstjdgnjdacgpj`enqegpqgcnpnfknphhioniiirmjbnoh_ene__ld^^jh\Zbf_^Zab_WZ^cYX^fbVadgZchjbbgjdaciidjd`Yd`XVcaUSa_YV_`]V[b_W]haXag``kcoju{lturkwjhzm]n{h[nm\[uh[dnbZgnf\lj`bmi_lh`hncejdfjbbh`di`cg`efaebbe`d_fbfceefeegedcdddeffebcedddcccdcdcecbbaccecddedfdeeeeeefeeggfjghiihihjjjjihijjjkjjlkkkkllmmmklmÿ|wztz{tokvniftvlov{rldkouielpoelstmgpqqfoqrjlfonlggpni_ijc^cpe_`ke]Zeh`[_ff_]efj]_ckf[aff[eei^aiic_eihacdjee\gb`WceZc[TWa[VU]][TZ`aV[dfWahaZej]]fhaeiwoo~xfol`wq`_zeYcs^YlpbYelgZerj^isaaqwbitpdszehrihvmgqjanmalmellckgcmccgbfdbbcab_caedfceedebebedeeddcbcdcccbaddbaccbacdddeeedeeedegfffffhghhhhihjhijiiijijjkijlkjkkkklkmllnÿzy~wqirugegqkfdnoulkqtuhoxwlmsvoimrtomgmqlhepkhajja]bne]\ie`\chg_^eef[_cna^djjaknnbfkkfdjlgcdfiac^kfbWcd_W\g\VWaZUUa\ZX][TZ`_U^ecWaecZeie]cgbb`heb^gf\_~p^duaWns[^rh[]no_^jp\_ov]htydvokz|mr}|mv|tqwzmuynsyonspispiokiomijjhlhghfjfhehcccbacadcedecgdecdeeffccdcdddbbcdddccdcddddefeeedeeefdfefgghghghhhiihiiiikkjkjlkklklkkkknnmmm~utzqfeooneelrnfmtylnuytlrwvopkqomejqmf`hlb_dod]ahfc]dhhc]bdj]_fog_ilm`hoqehnqjghpmjgfnif[hibWae]ZXf^VW`^WT[^^WW\`\U[bbZdaXbd`Zehb\^eda[cfaZac\XfaY\e[U_ueW`li[eppZbqn^pjiy}fv{jv~vovuro{onm}ujqvnexshstkotjjpjhpidogenddjdfibhgghfggdedeedebcdbececfedddededcdedddeddbbcddbdeeddefeeeeeggffeggihghhiiijikkikikhlkjkkjlkkkllmmoopn~}vrprulekowiktuojrwwmsovsodmtnebmlaaimfb_ggh`afmc^chnaekqjbjlmbhnpggmolfjmpkidojj^jmf]`h^YWc`YU]][UY^`ZT[]`VX^e]Zad_Yega[e`\]db_Xde^W`cXTa`WW`\WXb_ZZ_aZYj|c_lzdn{cx}qmlqu|rpv~wcrvm^srd_qf_fuc]lk^crd`pg^jk^eg^ck``h_ag]af]dd^fbcebdahdffgedffdcbcdefedbdddbddbacedebcdcccddddddedfedeeeeeefgeffghihihhhkhjihhjkjjkkklllklkmnmlmlm¿|srwxrktyvlqqvrskpvplirmc`infbbjfg`dhok_dinegnrkfooogpptkihlmihfpkk`kkhcfne``jd]\hb`Z^a^ZW\_^T[_cZX_gaW`cdZagf\^cf_^_fc_dc\U__WUa]UU^^XTZ]_UZ`^X^e_[`f]_}mrznw}qt}xrd~vmfwi^hvbXki[[qh[]ie]bkj]eif_jm`fjaeie_ee^de`cd_be_ba_ea`dbd`dacbeceefdeeeeebdedfed`cccdcedcdcdccbdbdddeedddeeedfffgfefhggfhihhhhjiihikjkkkijkjjjnmlllmmnnlo¿wxwxqrosurkjrnhdmtidhmmh`diqgbimofkrtngpqpenosnnhppmjgrmi`fkd^`lc__fe]]decZ^be`Z`dh[\`g`Y`fcZaddZ_eg^]aea^_`eb^\cb]Wa_U`[TS]\VU][]UY]aW]ddYafc[giabfhacuzpp~uen~m`tn\^wg[dp][gkfZbih[eoh[eoe]ntdeppaludhrjcpoajl_jk`gjbhibhhahgdibeabbcbaddbecfceeedbccccdddbbccdcddccbccdeeedeeedeffgefedeggfihfggiihhiiiiijjkjkkjkljljjlllmmmmpnn~unurnglvhbgolgcglslgnqpcmsxkkqrohnoupmhmqlgfpkf_ikb_dlf_]eea]aee`\bef^`ena^cjd]djiZegf^_dgc]_cd^`]dc`W`a]Y[c[VW^XTU]]XZ\YTX]^V]bcYcdd]`fe_`fcb_ff`[fa]f}k]braWko\]lh]]jnd\fq`_nvagrs^oymcruhjtxkmrojmtljnkinlgikfimehjeehffheigcgcfdfcfdeedacbdcfeededddddeeecafdfddddddededededeedddefffegfggehghhgghhihghiijhkjjjlkkkmkmjmjnnlnnnvnmsmeflomhelmrfltxnluuohmqroohqplhepogaimcackg`^edda`fkg^adh`_ele_gkjafmncdkkdbghga`afcb\cd^Z\a\WYb\UV]\WSZ\]WW[]XUZb^Yb_Xaa`Zbec`^bba[_d^Wab\Yb`WZaZWboi__im\_mo[eqi]nzidtuejzufmtrjlvpletnicssdipiaqnainccpecje_geagf^gd^fb_iaeebfbffeeceeccdcbddcddeddceadddceeebccdcddeeddceddedffedefgehffhghfhhhhgghijihiiiiijjljjkknlmlmmmml¿¿|umkmnpekovmluusktvwprkronfhqnicljc`emgabggi``ekd_egkecknj`kkj_ekkddiljfhjmgcckhd]bg`Z[b]YX`^UU\\XUY^]XVZ[^WX\c\X_b\[cd_`e_]\bb_Z`c^W^`WU\`WV^]XX_]YX\_[]fwi^kwekzucrwmhtymlpvminyqairj]noa_ne_bnb[fi^_kd[id^bh^^f`]g`[da]d`^b_^c_bbbdaedgbeddfdedebcdeedaccddcdcccccbbdcdcccedddddfeffeeffehfghghfghihiighefhjgijjiiljklkmllmmmmlnmoĿ|z||~rnrttiuxyorqwtsmmwrnemkbagofbaihg_chmjaejmddlnhelnmbinpigjjjdfflifaghf`bkc__fbXYabYV]_\YV]\]VY[_XY\b]W^`bY`ee[^bc^]_c`_ba[V]^VU^\VU[[YTZ^\VY^]V\b^Zac_exzkjvxjmuulkurkbvtfari_gr`ZfiZZlg\^hf^]fj_`fg]`kcaed]eh]ag_`f^^c`^e`bd^ac_dbbacbcacbdcedddbccbdddedcdcdedcbbcdfdedfedceddedeffefgegehghghhhghggiighhgjiiihkjjkkklkllmlmllnmmÿ¿}{tuvxtorrxtqisrkejqicbjhf_ciqibklnfhoqkdmmmbjlmilinljkdlkf`fjd_^ic^^fc]\bea\^a^YX\]bXY]a_X_abY``bZ_bc[\_ba\^aca]\b^WV`YW][TTZ[WTY[]UW\^WZb_X^a`Zbd]^af^lr|tmhwrciwe\oh]_rcX`i`YdhcX`fhZbni^gpjantedoo`lrfgnkcnmdijbgkacibcibde`eebg`gdeddbbbcccdbddeeddcbceeddedcddccadbddecedceeefefffgehfhifggehgghghfhjghjjiijhjjkklkkkkllmmmnnnpƿ¿¿¿zxnwuqjitmhfpnkefmpicgjleirrkfprofmoqljhkljfdpkiaimfabne]]ec`]^ed`Zbcd[^ai_]_d`YaddZ`dd^\bec_]`c^_\c`\W^]ZW\aXXX]WSV\ZXZ[^TY\^V\a^X]a_Y_ca\_aa_[cc_\d`ccvi]dp^Xhl][ie[[ck`[dka`lsbhpr_pulgqskioullmokkpoiikhenhgigehfefdaeicfbcdcddfefdfeeadbaeacahcecbccdcfeddcbfdbdcddddddeeefeeegeehhgefgghghgghghhgfhgfigihhijiikklkmnlmmlmmnlmÿ~{zsksnhfkllidlorjjptmgqrognqsonlnqmifqpkbfkb`cldaajjd`bffc]bch_`eih^ghj`dijabfga^afda`^ea`Zba^W\a[WW`ZTV\[VUY[YTX[\WUY_ZZ`]X_`^Y[__\[^__Z^a\X^]XX`]XZ`[WcneZ`gk\^ipZdpj]lwffttjlvuimrpknvqncolkaplcelf_jj_bg``i`]gd^fc_`b]`b]b`_d`adcfbefdededdbccdcdcbcdabdccdbccdecbcdeeedcedeeeeeeegeffggfgffhhhghhfggfggighiihjijjlkmllklmmoknnm¿|zz~snjonphilsoiqttlqutonkpqnklsojemlfcfoibaegd_bfigaeemcbgmkajkldgmmgdijhdcfjeb`dc_Y_d]Y[aZXX_[WUZ[XTW[[XTX\[UX[`XY]_[Z_aZ\a^[Y]_[U]`YW[]VU^]WX]\YX^_Y[\``[gxcajucixucruokrwlmltojiul`ipg_mh^\ib]_jaYbf^\gb\ad^]e_\ba\bb]_`]_`]a`_```aacdcbbccefddcccbccdcebcdcbdcdcbbbcecdddcddddddfgffgfgggehhgghfggigfhhhhgggiihjhijlkkkllmlmolmmmm¿}z{yztmrrtkpuwnonrsrmmsqignnffiohgelkjddgljadekcdjnkckmngjmpkghllhfflhf_ffc]^d^][b]WV]^WUY\[WX[]ZTWY^WXZ_[W]_]Z^a_Y\]^]]\`_[]]WV[ZUT\\UU[[YVZ]]XZ^]V]b^\adjhyzllsxlmswnhrni`sk__ma[bn^Xff\\hea[bda^ci``df^`jb^ce^dg]bfa^f`_ab_ca_c_`ebcb`bbabbbdcdbcbccccdcbbcdccbbbcbbeedcddcedddddeefdehefhgeefghhhhhfigffgiihghhigjjjjjllllkmmlmmmnn¿x}tquutnsqurognrmglrmffokkgilomflmpikpppclllflonkkgkmjifnoj`fifa`gb^\cbZZ^`]Y\]\YUZZ]VW[`[W\^^W]^_Y[``[Z\`]\[^`][Z^[WW^XW]XVUYXXTW[[VX\^Y\bcZ_a`\be__adollytggtmahpa\jbZ]l_Y_f`X`eg[_fh\cjh\fjg_imebjk_gldbigagh_dgbbfb`dc`ebacbaebdcdcdac`babbccaccdbccbbbabbccbecebdddddccbddeeedfefgfgfheggfgfggiffgggfgegfhihiiilklkkllnmklnlnmmzxtosspnlsodgonlginpoilqsjnquslqqqknnsnkgjljjgnjgcgkeaaje`]df`]`bb\\^^bYZ^b\Y\`^X]`_W]`a][`a]\Z__]\[`]YV\[YV[]XUX\WSWYYWZZZTXZ]W[^_Y]`_[^ba]^bb__bb]Zbe\`r`Zel_Zfd^Yed][ck_\fl_]lp_gnj_loickldejnfghkdgigfeigcidbecabdb_ca`dacd`ddbdbcdcddbabbbb`dbcadccacbacdbcddddeecddddecccceeeefeffffdffghfhffgghfgghhhhihkkiklklllmnmmmmmlkpm¾¿{w|xpkqslhmpmjfknrljpwrmuxwourvrokopnjfnmhaejfbejd``ghc__fdd^bbe^]`ea\^bc[^db]_ab\\`c_\\]a^]Y^_[VZ]YUV]WTU[XUTYXYTWY\UWY^YY]\X^_^Z]__\[_^]Y_]\Y_]ZY_ZWZ^^Y`ig[`di\alk[gmd_opbfnnbipnbimkfflmhbjie`kic`gd]fe^`e^]fb^cc[bc]]b^_b]`b^bb_b`c`bbbabacabccbccccbbaaaaccceddcdddbccecdccedeeeeefeefhfgeeffgfhffefgfhhiihhhjjkkkkkjnlnmmllnnn}zux|rmlpqskmotsjsuunrwyrttzwvsmwpjekleacle_bggfdeghdaachb`dgf^cfgbcfh_^adb^_dc`^[a_]W_`[XZ]YVV]ZUTYYXTWXZUTXYZUY]^XY\^X[__Z]_\\[_][X\^YW\ZVV]ZVV]ZWY][ZX\k_\iscamp_ksj`mnehlphgfmiefpj_fjd^hg_[fa[^ga\`e^]bb]^a`[ab]`b]^_`]^^\`^^a_`a_b_a`abbcbbbabcdaabbcba`cbbccbedccddccdccddcdcdddgfedfeeddhfeeffhfgfffffghigihiikklkklllllmnlnnom¾}~ywvwwulprxspwzvsvywsrqwvqpvslllpieaiggcaegf`aeleagjhbgijdeiigcghfabbeb`[``_[\a]ZX^[VT]\WVYZZVVZ[XTWZ\UW[_XX\]\Y]_\X\]^\[\]\Z\\YVZZVV\[WUYZYWZ[ZWZ_\Y]`\\`qeeqqeipnggnpicmjfamg_aj`\ej][db]\fd^\cb`\`fa^af^bfb^cd]cgb_d__bc^ca`ca_ba`baa`bba`aaaa`bcbbbbbcaa`bbbbbacbdcdcbdbeecbddcbddededeeeeeeegfefffghffffghhjiighjijkklmlmlmmpnnnnmý{}x{}xqxxzqut{yxquxplltolmsnpkhjlh`dgjbbgkj`hjjcfkjfffgieebhie^dga\]b]\Y_]YW\][WX[[WY[]^VXZ^ZY]_[W]^\X[^_Z[Z][ZW[][V[[XVW\VU[YTUYYYWX[[VX\\W]^^Z^_][]`]]_pjggrmeeng^il`]h`Y]g]W]cbZ`ce[_eg]big^fhf`hkdciibikcbefbehbbccaddbcc`bdb`bcbba```ccbaba``abbababbbbbdbcdcebbcdedcdbdcccdbccefdfdeeefefeeedeffhghhghggjgggfghiilmllklmmmlnmomp¸¿~|xuqwyuspyxpnttqnlsrploqwmlprjcikjdgjlihgjjhfdjgd^cgb_^fc^^aa]Z\^][X[][W[]_YZ\^\X_`_Y\]^Z\\_[[Z\\[WZ^[XVZYVUZYTTXYUSWYYTXZZVY]]Y]^[Y]^[Z\_]\]`_\Y_]ZZnf]al_Zcg[Xcc^\`e]\dk]`ejackk_ilicnngdhjfefjggbhe`hfd`ea]eb_cc`aba^a_]`__a`_a_abdcbbbababaabbacbbabadbcdcfddcdeccddcdbcdcdceefedefffdedffdefeghgfgfigjghhijhjijlkmmmlmmlmlnpp¿zzspqtpoqurrmrrxrnsxqlrtrloopiigjiheaiidadg`^`g`^]bb`]_ba`\`_c[\_a][`a`[`b`Z]__[]\a`^[\^]YX_\YTYZUSW\TSUZWTSYXVTWWZTVZ\V[]ZX\]\Z[^][Y]\[X][ZV]ZWZ]ZWYe_Y_cf\[dg[`ig]hlccmpaikldjnkeekjhbjie^fdb^gd^^e_\d`\^b^\b^\^^[]a]]`]_`_^a^_a^aaa``aabcbabaebaa`acababcdddcddedcbddceccecdddedefdedcecfdedeeeggfgfffiifghiijihikklllllmmmpqop¾|~~yu{tomrssqorwxqwxztuvxqnorpojgkjf`fhb`bgb_]cca]_aeb]abf__cfeaeed^abd]__a`^\^_^[Z_\\X^]YUY[UTV[WTSXWVSVXYSWWYYUW[[VWY[WZ\\X[\\ZX\\ZW\\XVZYUWZYUW[YWX\\XXci^]enaelj_npicklefglgeclgcekc[de^[eb][b`\\b`]\`a[`b^]`^]`a]]_^\_`\`b^_a^^`_aa^a`a`bba`aabca`a```b`bbdecdeeccbcecaebcedddccfddfddeefdecegecfggggggeehgihhhjhjjkklmmlnlnnnnnoq¿yw~zxxvvsmquvrqy{yuxyyurotrokmohfekfa`edb_adfd_bde``dge`gee`dfhddcfaa`^aa\X^]ZW\^XVY\XVW]YVSWYXTVXZWTVXYTWZ[VWZ[YX[\ZXXZZYXY\ZX\[XU[YWVZXVUYYXWY[YW[\ZX\_[Zlnbgondfklhfmkgaje_aj`Z_e]Zac\Y`a]\`da\^bb\ae`\bc^aea]bb^bd_`c_]bb_aa``a_ab``a````bbacaacc`cab`_aaabcbdcddddcdccedeccecdcddddcddedeeeeeddefgfgfigggggfhhhihiijklmlmmmmmnmpopo¿|}~yvx|wqvxysuv{zxtswrkiqkginjiefhhg`ceibdgifagihaeehee`ddbb`ge`]aa[Y[`[WX]ZVV[YZVWYZWWYZ[TWY\VWZ[XX[ZYVZ][WZWZZYX[[YUYZXUXZUWXXUWYYXVX[YVY[[X\\ZY]][\\^[]gmidemi^dg`\ga[]d]X^e_Z^bc[_bd\`ee]che]eeb`eg`bdd_bfabab_bd`_``__``_`_`c```__c`ba_ab``a``adaa_aa_``bbcbcabdcccccccdebccedcdddebededcdcedfdeffhgghgefhihhhkijjjkllmklmmnoopprp||{xzvurtvurqwvpotrngjnokgjkogikmhciijcfgieebffda`gb_]_b^]\b_\[_][X\][YWZYZUY[]WXZ\YY\][Y[\]XYZ[WYXZZYVY[YUUYXWUYYTUXVUUXWXVXZYWZ[\Y\]ZZ[\YY[][ZY]\ZZ][Z_h`[`i\YbbYZb`Z[_d]^dg\_eg^die^ehbcdhcabgdbbfdb`da^bb^_d^]``\__\\a^]a_]a_]``^aa`abaaa`aaba_`a`aababbccacccdcdbfaddbadbccededdcdedeeddeeecfgehhgheegfgighiikkijkkklmmmmnoopmprĿ~ysyvpmqvqorvrrmmoskkqsojppnjkknhhegffc`hfa^cb_^^b`[Z`_\[]``\Z]]_YZ\_YY\][W[^\X[]\Y[\]\YZZ\ZWVZXWUXYUUXWTUUXVUSXXUUXXYUWXZX[]ZW[\ZZ[]\[X\[ZX\ZYW[XWW\YW]a]X[acY\caZ`h`\dhaeigadffbcgfe_eec^ed`]db^^d`]_a\^`^Z]b[]`_\_^__`^\_^^^`^`aa`_`bba`cba````a_`a``abbbdbbacbbdcbdccdbadcccbbccddceddddcbeeefffhfhgfhhhhhhijikkllklklllmmnpmpoo~}ytwsqnortrpstvnsssmoqrnnlpomhflgd_dd`_`d`^^aaa\]`__Y\^b\^`c_[_``\^`_Y[[^ZZZ]\[ZZ\[YW\[YVVZUSVXVTSXYTUWXXTVVYWUXYYVYYYVZ\\Z[\[[Y\[ZX\\YXZWVVZXVVXXWWY[Y[be[_fi\dhb_gi`bfheadie_bfc]bd_\ca\\d_\\`_\]``[]``[^b_\_^^]`_]__\_`^]^aaa`_a_ccaaabaa``b`a_`_````aaccbcddbacccedcccdcccbcdcdcddcaddccbcgffeefhhgfeefghjhikjjjkknlmlnlnpqoqopp~|{usutopqvtvxxtrrtsqnosolhlmfcdhb`_ca`]_bc`]^`d\_ba_[^b`\_db_^^_^^]]^\ZX[[ZW[[XVXYWUV[XUUWYVSTXXUTUXYTXZZVYZ[WWZZXXY[YYY[Z[Z\ZXWZYWW[YWWYXWVWYXVXYXWZ\Xbgh_bihcbgeb_gg``gb[af\[``Z\cc\[a`^Z^`_[``^\^d`^ab^_a`_b`^ab`_a`__`_ac_`baaabba```ab`a`aaaca``ababbcbbabccdcddcecdbbcbbdbbccccbdcccccceeeefeeeefeehghijhijkimklllmklmlooooppq}~{vxxsoswutwuxwunpqmklojiimiebbdfc`_ac_^ceb`ccc^abb_]^`_^_^a_]Z^_[XZ^XVW[YWUZYWUXYYVVXZYVYX[WXZZWWZZYUXZYVXYZWXWZYYWZXXVYYXX[XWVXYWWX[XXZZWWZZXX[[XZZ\[`chd_cgb[dc[\f^[_c]Yab^Z^__[_aa\_da^aea`dd`bddaabb^ac`^`b_`aa``__^``__`__a`_aa`aabaaaaa``a`a`a`aaababb`cbdbbcdbdcecaccbbcdcbcadcbbddcbefeefefgfegeefggjjjjlkkkkkllmnnmonpqqosÿ¾¾¾}zy{xtorvuqpurmkppmjknolikjiddgie`eec_bde`cabb___b`^[]_\[\`\YZ][YWY\YUVYYYVXZ[WXY\XW\\ZXZ[ZY[[ZYXXZXWVZYXVVXWVUYVTUXXTVYXYVXZWWYZZY[\ZY[\ZXX[ZWXZXYZZZZ_c\ZabYXb]Y[`a[\_d]]be\`dc`cga`ee`acfbbbfba`cd]_b`\a`]^`^^a_^^`]\`\]___`a^a`a`acaaaaa_b`b`b`a`aba`bbbbbbacbcdccbccbccbcbcbcbccbabcaeeeefefffghggeggghiijijjllljilmmmnnoooqpq¿}wuyusnsvrnrrrmimmqljoqmjlkgdfhgccdddba`dc_\_`\[^`]YY]^ZY[]][X[[[YYZ\ZYZ\]Y\]\Y[\[YZZ[[[XZ[YYX\YVUYWTSXYUTUXVUUXVVTWXXVXZZXZ[XXZ[XXZ[ZYX[YYWZXWXYXWX\XX]`\Y]__Y]`_]ah_adf_dhe`dfcccheb^dd`_db_\a^[^b][_`\\`_\]_]^__\^^^\_^]]`]^_````aa`````ab``caaaabcaabb`bbcbbccccbddddaccbcccbccbbcdddccedeeefgeggifgihiiijkkjjkllllnlmnmoopoprrľ{vtxtrqtstpqruunppqlnpqmnjkheecgeb^ac`]^c]\[_]\Y\^^\X\[^Y[\`^[\]]W[]\Y\[\ZZZ[]ZY[\ZYX[ZWVXZUTWYUTTWWUTWVVSUVWVTXYWVXZYXZ[YYYZYXYZ[YXZXWXYWVXYWVWXWWYXYZZ_cY`ee\cd`bghadfgcaefc_bf`]cb^\b^Z[b^\]`^Z]^^\^^^\^_]]_b]_a^]`_]`b^__^``b__`ab```a```_a`abaacbbaacbbbbbacbbdcbccccdcbccbcbcccbccdecdeedeefghghhhifijikiikklllmkkmooooonopppÿþ}zuuwvqvuxrsyvsoprpmmkqljfhfb`_f`]]```\^]a][]^b\\_``Z__`[]``\\\]\[ZZ\[ZW]ZZV[[WVYZVUVZWUUXWXTVXXVTTWVTXYXVWXYWWZYWXYZXZYZZXXZYWVYWWWYXVVYXWWWYXXYXWYY[\acd_dgdccfaabfd^ac^Zc`\[``[[a^[\_`^[^`\[]`_\`a^]__^bd^^```ab```_^`_____^___`aaa```aaaab`aa`aacacccabaaabbcbccbccbbdbbbdcccdcdcdccfddeeedfeeeegfhggghjjkijklklllmmnononpqopppľþ¿¾||{zu{{ztwxwwsprpjjknjdchda_``b_\_bc^_ab`]ac`]_cb_^_`_^]]`^\Z^\ZXX]XXV[XUVYZWUXWYVUWYXVVZZVXXZWWXZVWYXXWWWXWVXYXXWYXWWYYWXZWVWXXWWXZXWXYYY[[XY[YYZ[[b`dca]dd_]d_\]c\[^a[Z``]\\_][^a^\`b^_aa^_`a__ac^^^_\aa^_a_``b``_a`__`\`_``__``^`````_aab```ba`aab`aacccbcbadabcbadbbbceaccbcaccccbcdeeefeeeehggghjfgiijjjjljmkklommpoonpopsop¿|{xyzystxtppppiihjhdcede`bbea^bdb`bcb__]`_`]]`_^[^][[Z^[XXZYWWZZZVWX[XVWZYVXXZXXYZXWZ[ZWYZYYXWXWWVWYWUUXWVVXVUWXWVVXYXWXYXWXZYXY\XXZZYY[\YZXZYXZZ^X_]ZZ`]W[`\Z^``[\_`[^cb\_b_^dc^`ab]_ab`_^```]b_^^`]\``^_a``a`]``_``^``_]^_]``aa`__a`a``aaabbbabcbbaaaabdcbcbbccacbbadbbcccebccaecededdeeefeeffghhhijikjkljkklmmnomnonpnpopon¿xw{{uutvtrqnongikmhehgfadddaaacb`_`c_][^^[[]`[YZ^\ZY[Z[YWXYYWYY\ZXZYYWZZZX[YZXYZZZYXXYYUXYXVUYVUUXWUTUXVUWWXWWWYXUY[YXZZXYYYXYZZYXYZYXY\XXXYXXZXZX^]ZY\`]Y^b]]cc[_c`]cea_acaaaaa__a`^^a_^\_^\^_][]^]^`_^_`_]``^_`a]``_^^__^`^`^`_````a```baaabcacbcababbaabbbaccdbdbbbbbbcdbdccacdeeeeeeeffeefgfghihiijjklkjklmnlmnnpppopoqpq¿}zzz|{xzw{xqrpqjlmmigffgc`ada`\``][]`[[[][[Z[\][ZZ\_ZY[^[X\\\Y[]\YZ[ZXYY[ZYXZZYWWYWWVXWVVXXWTUXWUTWWVTUVXVWYYXXY[XYZYYX[ZYXWZXWWYXYXXXWYYYVXYXXXY^X[__Z_c__bd^`bb^aba`^ba_\a`^\a^[\_][^_][]`^^]]_[]_^]_`a__b^`aa`bb`b_a`a`__^_a`aba```b``ababa`cacabadbcbbccdcdbacbbcdbbbacbadbcdddedeeeefefegggeighghijkjkjkjlnnnmnnpnopopnrs½¾~y|}~wtrqpmjikhgceba]_c^]\_^][]__][[\^[\^_\\^^^[]^_[[[[[ZZ[\[ZXZYXWZYWVXXVWVYWVUYWVUWXYUUWXWVWWXVXXYVXYYXXXXZXWYXWXXXVVXWUWYXVXXZVXZZXXYWXZ\^]aa]\`d_^`ca^_b^\`_^[a`[[`^[\^\Y]]^[]]`\\^___`_]_b^`_b_`ab_bb_abaaaa`_a`^`__`a`a``a`aaabaabbbccaabbbabcbacccbdbbdbcacbababadbbddddedecdggeggfghhhiihkjjkikkllkmmnnnnoomnqpooŽ½¾}wtnpokfggcaaca`_]`_^\\^_\^_b^[^^^\^`^\]]^_]]\^\ZYZ[XWY]YWXZXUVXXVUXXWVVWYXUXYYWXYXWXYYXWYWWVWWXWXXYYXWYYXWXXWXXVUWXWWWXYWYYZXY[ZXXZXYY\a_]_`]\ba\]a\Z^`Z[_][\_]Z\]_\\^`]]``]```^^``^`a_^___a_aaaaa_`bbaa`a_ca^``_``ba_``_a``cabbcabadbababbbbabbcbacbcbbfabcbbbaabdbeddcdddeeedghefgfggighgjjjjklklkmnmmnoonpopoqpqpyxrnonmieeeeaa`ab]__c`\_`_]```^^\^^][\^]]Z\]\Z[\YXXZZXVYZYVYYYWUVZYVXXZWXZ[XVXZYXYYYXWXXXXVXWWUWWWVWXXVXXXVWWXXWXXWXXYXXZYXY\ZYYZYYYYYZXW]ZX^]Z\a\Z]^\Z]^][\`][^`^]`a]]b`^a`_^``b`__b_^___^`a__d`_`b```a_``a_``_`````^``_``b`abadaabbbbbbcbaa`adbddccbcbcabaadadaabbddbaddedeefdfefeeffhfigiihjijlklknkmnmjmnnnnnopqpqÿ¿¿~wupmjlkiecfgcacba``d``___`_^^__\[^][Y\][YY\\ZW[[\YXXZZXXZ[XX[\YXY[YXXZZXYYYWXWXYYVWYXWUXVUTWWTUVXVVXXXWXWXVXWYYWYXYZ[XYZ[XXYYXYYZ[YXYYXWY[XY]]Z\^_[\^`\]a`\ab^_aa__``^aab___`_]__^]]`[^__\^`___``_`b_``a_a```_a`a```_````_a_``bbbbbcbbbbbbcbbcbccbcabbbaabaaaaaababdbbdcecddedfeefdffegghiighijikkjklklnmnmnmmoompqnrpxqrsmhlihdgghcebcbb__b`^\__\\^^ZX[[[[X[\]]Z[\]Z[\^ZY[]\Y\\[ZZZ[ZZXZ[YWYZXWXYWVVXXWVXYVUUWUTTWWVVWXWWXXXWWYYYYXZXXYYXYXZYXYXYXXXWWYXXYYYXXX^[Z^a\\ab]`a_]`a___a^__a`]]ba\^`\[^]\[`^\\_\\\^`]```]_`a``_a```bac`a`a`_``abc`b`b`aaabacaabecddcb`aacabbbbbbccbcbaacbbcbcaacbcccecedeeegeghfeghfhgfijikjjlmkllkjmlnmoopqoopopſ|rtrrmlmkheeggdbab`_]^a^]\^]\Z\]_\[\]^Z]^`[\^^]Z\\^Z[Z][ZZ[[Z[Y\ZYWYYVWXWVUYYWUVWXVUVWXVVXWYVXWWVXYXXXXXXXYXYXWXXWXXYWXXWWXXWXXYYYY[YWY[ZYZ`\\c`]_ba^_``_]b__[_]\]`\[\_^]_a\^\^^\^]^\_`]]````_caaaaa_b``aa````_``a````aba_aa`aababbbbbcababbdb`bcebbcccccdcbddbcbbaccbdecdacddedfffefffefefgghgijjkklkkklmlklmnmnnonoppoÿ{xrrsqpmkijd`dc`^_b_]\\^_\\]]_[^_`]]_]^\]^_\^[]\\\\^[[YZ[YYZ\XYWZXXWZWWVWXXUVWYWUYXXVYYYWXYXVWXYXWXXXXXXXWWWYXWXYWXZYWXXYXVZYXXYZYYYZYXZ[[XZ`^\^a_]^`^[`^][_\Y]__]]_]Z\`_\_``]^a^]^`^^```_```_`bba``_`baa`a_``a``ab```a__`_aaaabbcbabbabbcccacbaccdbbccdbbedcbccbbacbcceddcdeeeeeefegggfffieeegijjhiikmjklmlmmmnmopmoosqq¾¿}vwwtpoqnkjlgdbdac^__`_]__`^]__]]^__]^^^__]]^]\Y\\[YZ\ZXZZZXWZZXZYZ[XXZZYWXZXVXXYWWXYYWWXXWXWXXWVXYXWWXWXWXWWXXVVVYWWWYWWY[XXYXYYYYYYY[Z[YYZZX_][\_\[^^Z\]]\[]_][]_\\_`]^aa]`_^__^^^__`___^`^a`__cb^aa^aa`a`a``````a``aa`_`ba``abbdcccabcdc`bbbbbcdacbdbdeccddccdddccbecdcceedddeededffegffeeefgfiihhikjlkllkkmmmlonnnnorpn}zxupopppnihhebdcd_aba`^`aa]``__^]^_]\[^[Z[[][YY\[[Y[\\ZWYZXWZZ[ZXYZYY[ZYWY[XVWYY\WVXYXWWXXWYWWUVYXWVWXVUWWYVWXYVWYZZXYYYXYXYYZ[XWYXYYZYYXYYYY^ZY]]\Z]\][]^][^`\]``^_`_^^```___^]_^_\`^]]_^^^`__`aa``b`_```^```````aab`_aba`ab`bc`c`acbbcacbcbbabacbcdbadddacdcbddbbccdbddccccddceeeeeeeeeffffgghhghiijjkljlllmklmnqpnpppnp|ytpnqssnljhgeeedbacaaa]`a`_]^\\[\]Z[[^\[Z\\]ZZ[[\Z[[\\[[YYY[Z[YYZZZYZZYYWXZVVWWWWVXXVVXYVVWWVVVXYXWWWYVWXXWVZXXYWXYYY[XXYYYYYXYXXYXXYXWYZYXY^^Z\^_[^_^]`_^]^_]]__^\_`_^`^_[_]^\_^\\^\]^`a_`a``_a_``aa``c`aa``aaaaab`ac````abbbcbbccaababcacbcbbcbbbcbbdbadccddcbdbdcddddeedeedfeeeeefihgfffgffhhhhijjjjkllmkjlmlmmpooppooſ¿¼{usptxunmihfecddb``a_^\^`]Z\]\ZZ\[\Z[Z\]Z[]^[[\\\[[\][[[[ZYY[[YXXZ\YWZYZWWYVVVXVVWWXWWVZVVVWXWXYYYXYXXXXXXXXXYXYYXXWXWXXXXXWYXWXXXXYXZZYYZZ[`_\^]]]]a_]^_^_]`_^^`^^]^]]_^\]^]]\\^^]__^_^```acaaacbabaa`c`aaa`aca`ac`_b`aabbabbbaaccaccbbbcadddcabbcdcccddbdccdccdebeeeddeeeedddefegeeeefeeeeeggfgfghhllklllllkklnnnnopnqnĿ¾}wvsuvsnkggebabd`__a]]]^]_[\\]][]]]Z[]]][^]]\[\]\[[[][Z[YYXWZZXWYZZXYYWZV[XVVWXYWVXXYWXYXVWZXXWYYYZYYYYWYYXWYXWXWYXWWXXXWYXWXZYYYZXXZZXYZYY[_`^]^]^Z_^\\]\\\^\^]^\[]^]^_^]]\`]]]]]^^_``_babbb``baa`caaab``aa``ba``da_a`bbbaadcbaaccbccccbacbabccdbbdcdadcbccceeceeedcdecbdbddefdfeeffeeffffeeeeeeighifkkkklllmnmnmnoooppp¾½wvvrstojhefca`b`a]]__^[]_`^\`\]\]^_\\\^]\\\^]Z[\\[[Z][XZ[ZXVZZYYWYYWZXXXXYYXWXXYXWXWXXVWXWXXZYZYYXWXYYWYXXXWXWXWWXYXXXXYY[XYYZXZZXXZYZZYYZ[[^_\\^[[Y]]ZZ]\[[^\\\^^\_a^_^`^_``^^``^_^_`^`ab``baaa_````````ab``````aa````a`abdabbacdcbbdccabcbbbbdccccdcdddeddceddfefeedcedecedeedddeedeeeefefefefehfgfhiikkmilllnloonooonn¿ſutrprrmkeeddb`acca_a``]___]_^]^_]]]\\Z\][Y[[[Z[[[Z[[\]Z[[[YWXYZYYYZYXYZYXZXXZXXXVXVWWWVXXVXWXXXXYYYYYYWWWXWXYVXXXYYXYZYXX[YXY[YYYYYYY[YYZ[Y[^][[[[[]\_][\][^`^_^_]^`a_^_`a____^^_`^___^`ba`a`a``aaaa``````_ca`abbaaaaaabaacbcbcbcbccbcdcbdabdbecbdbddbccdecdgeddeedfeeecdeeceeeffdefebfeffddfeeegdfeeiijjjlmlmmmnnonqnopovsqonomlfeddcbbdca`a`_`^_`_]]^]ZZ]]\Z[\\[[[]\Z[[\\Y[\^Z[\\ZYYZYZ[YZZYZZZ[XZZZWWXXWVWWWVXYWXXXXYXXYWXYWZXXXYXX[YYXYZXWZYWWZWYXYWYYYYXYYXYY[[[]^]\]]][]_[^^^\^_^_^a^^^`__]^]]__^\_^]\_^a_``a``aaaaaaaaa``ab`baabaaaa`a_``bcccbcaabbabbcbcbccabdbcdbccbcdcddddceeeeegeefedeeeedeeeedeeeeeeeefeegeefeeeeffhkjlkkkmnlnnlqponon|trtrnmlfegdbcaaca_aa^^\^_][]^\\[\\\Z[[]\Z[]][[]]]Z]^][\\[[[X\\YYZYZXXXYWVYXXVWYVXXWVVWYVXWXYYXXZZYXZ[ZXYYYWWZYXXYYYYXXXYXYXYYZXYZYXZZZ[[[[[^_\^^^^\^_\]]^^^]a^]_][\^^]^_^^__^^^__]^_`_`a``aaba`b`abb`cacacaaa`aa`bacaaabbacccccecbbccbabbabbbbcbdddceeddddeeeeeeeeeeegeeeeeedddeeddfffeeeeefeffedeeehgkklkkkmnlonnnpnnnoÿ½xutrpmmjhfefcb_``_^_`]]\]]^]\\]\Z\[_Z\^]]\]^]]\\]]\\]\\[Z[ZZYXXXXZYXXXYXYZXWWWXVXXVVXWVYYXYZZZZYYYZXWYYXXXXWXXXYWXXWXXXYYZZXWY[ZZZZZZ[[[\[\[^__]]^\\]^\[]\[[]]\[]\\]]__]_`^]^_]_^`___b```a`aba`abaabca``b```a``abab`bdbbbaababacbbdbcccbccad`cbbbdcbcbddddcdeeefedeefcdeeefeeeeeeeceddefeeeeeeedgeeffhiikkkmmmlmnlnooporo¿zssrpmkkfcddb`_``_^`_`]]_^_\]_^^]_^^\]]\]\\\^\][^[[[\[[[[[[ZZ[YYYYXYZXYZYWXZXZYXXYXXYXXYXYWXYYYYZZXWWZYYYXXXYXXXWXXYXXZYYYYX[Y[XYZZZZZ\\[\[[\^_]\^\Z]\[[]]]\^]^]]_\^^_]_``^`____a__``a`a`ba`abaaaa`ba``a```b_a`baabbabdccbbdcbccb`abbccbbccbabbbbbcccccdcdeeeeefegeffgeefeffdeeeeeedededeegggfeeeeegfhjjkmklklllmpmnmlqnm}trrokhgfccddb_aaa_`_`a]`__]^_`]^[^^[\[\[[[\\[[Z[[Z[Y[\Y[[[[ZZ[\XYZZYZY[YYZZYYZYYYVYWXXXYXXXXYXYXYYYWYXXYYWYWXYYYXYZXZZYZXZZXZYYZ[ZYZ\[[\[[[\]][]]]\]\^[[^^\^`^^^___^_`__^`\_^`^__`^a__```a_a_``a`aac`ba````cabbabbbabbbcdcdaccbccabcccccccb`bccdbdbdcdddeeeefeeegfefefeedfedeeeeeeeeeeedeegegfgefhhghijkjknmnonmnnnpopomĿ¾{vsrpkkgheddeb`ab``b`a^`]`_^]]^][\]\Z[[]\[Z\\\[\Z\\Z[\[[Z\[Z[[[ZYZZZYY[[YYYYZXWYYWVYXXWWYXZYXYXYYYYZYYYWX[[YXWYYXZYZZYYXYZYYY\ZZZYZY[[Z[\[[Z[\\\\^^\]]]]^__]^^]^^_^_]_^^^_`^``^_`^_`_```_a`a`b```a`aaa`aa`a_aab`aaacdcbdcadccbccacccccadcacdaaedbbcccdcdcccegfeeeeeegeeeeeeeeeeeedeedddedeeefffeegfhhhijkjnkolnnmmoomnonn}zwspikhgdffecabca`^^`^^\_]]]]^]\[\]][[\\\\\]]\\]^]Z\[]Y[\ZZZZ[\YYYZYYYZWYXXXXWYYXXWWXXYXYYYYXXYXY[ZYZZYYZXXXYYYXXZYYYYXYXWYXYYYZY[Z[[]\[[\\^^^\^^^_^]]_[_]^^^_^\]^]_^^[^__^_`^__``_``^`b```aa`a`b`ab``aaaaaab`bacbbdbcbcbccbccbbccabcbbbdbabbbcdbcbcddedgffeeeeeffeeeeeffddfefeeddeeeeeeefeeefeefghikkikllkmnnnmmnponppoÿ}{ysnhhhhfdddba^a__]^_^^^^]^]]]^]]]`]\^^]\\\]\]]\\]\\Z\\Z[[ZY[\ZZWXYXYYXYXWXWWXXZZXXWYWYZZZXZZ[YZYYZYYZYYYYZZYWWXXYXXXYZYYYXYZYYZZ[[[[]Z[][[\^_]]]_^]__\]^\\\^[]\\]]__`^____`___ab`_a```bbaaabaaba``baa`ac`aca`bbbdcbbbdddccbaddcbbbacccbbbcccebbdbeccccdefeeeeeeeeefgfeefdfeeedeeeddeeefgeeegfffggiiiikkkllmlmmmnnnnnpoo¾ÿ¿zwvunjgfeebdcc`bb___^^_^^___]^]^]]^^^\\]\]]\]]]]\^\\[[Z[[[[YZ[\Y[ZYZZYYYZYXZZYXYZ[XYYYYYYZYZYYYYYXXYYYYYZYYZYXXYYXXYYYYYYYYYZX[ZZ[Z[\[Z[[[[[^_^\[]\\\]\[]^]]^_^^^]_^_^_]`_`_`b^``a`aab``_a``aaab```abbabaab``babccbccdeddccbcdccbcbddbcccedccbccddcbcceffeedfeeeffeeeeeedeeffeedeeeeeededeeefefehhgijkjjklkllmnlnpnrpnnqsÿ¿wtqpliegffbcdbba`ca^_``^_^_a]\]^^]\]]]\^]]\[^\\\]][\Z\Z[ZYZZY[[[[Z[[ZX[[YYYZYZZXY[YYXXZXXYZYXZZWXYZ[ZYYZYYZ[ZYYYYXZXZZZYYYYZYZYYZ[\\[[[[[[[[\^\\\]]\\]]\]^\^^__]__^`\^\^`_^__a__`a```````a``a`a`a`a`baaaba`abacccaacccccddccddcdbcdadaaceccbddbccbddccgfeeedeeeeeeeefffeefefededeeedddeeeeeeefgfghhihijkkkklmmllnoonoppoo½wrpmkgegfffdecbaaa`___`^^^`_^]]]][\^]\\]\_\\\\\\\\]\\[\\[[\][[\[\[[ZZZZ[XZZXYZWYYYXZYY[YWYYZYYX[YYYYXYYZYZYZYZYZYYXZYYYZWYYYYYYZ[[[[[[[[\[][\\^]]]^_^_^^\\^_^^^`]^^]]_^_^`]_]````````a````````a`aaabaa`aaaaba`adcecddccdcdbbbdcbbebdcbcdbdcbdddcfdbbcedegcddeefeefeeeeegeffefffdeeeeeeeeeeeeefghggghijlmjjkllnlknmonooprswspmnigihfdcddcaaca_`^_^^]_^^]]]]]\]]]]]\\^\\\]]]]]\\\\\[[[[[[\[\[Z\\YZZYYXYXXZYYZZZ[YYZYXWYYYYYYZYZYZZY[YYZYY[XZYYYYXZYZZYYZZY[[[[[[\[\][][\]\\]`^_]__^^]\^^]^^]]]]]]\]^____``a`aa````a``````aabaa_`baaabaacbaddccdcdcddccceaecbbbcccbdddabcccbdcccddddefegefffedfeffeeedeeedefeffeefeeeeeffgggihhiihhjimlkkllnonnmoqrsq|wsopmjhfhfedbbba`a`^]^^]]\`^^\]\]\]]]]]^^`]^^^^\]]^\]\\\\[\\[Z[\[YZZ[ZY[XZXYYZWYYYYZZ[YYZYYYYYYY[YY[ZYZYYZZ[[YYZYYZYYYZYZYZZYZ[[Z[]\[[[\\\][^^]]^\^^\]_^\]]]^^^^]^^^^^_]^_`__```_b`abaa`````aaa``b_aaaaabbbb`cddeccedcdcccddddecccbbcddcdcedccbcdbeeeegfeegeeeedfeeeefeeeeeeeeeeeeeefeeeeegfffggghihijikjklmmmkmnmnoqpnrq~xtqnnmjffggdcec``ab__^^^^^]^^^^_^]]]^]]]^^_]^]^]\\]^\]\^ZZZZZ[[[Z[[][[ZYYYZZYXYYZYZYZ[[[YZYZYYZYXYYX[[ZYYYXZZ[ZZZZYYYYZYYYZZ[Y[[[[[]\\\]\^\\\\]]\\[_]]]_^^^^]^_]]\^_\^]__`_```ba``baa`a````aa`_`aab`aaacbab`accddcceeceddbdccdcbbbbcccdccddeedeccbecefeefefefdfffdedeeeeeeeeeddfeefffeeeffeffgggghigijkijjjllllnkmmonoorrqussomnljefgeddaad_`_``____^^_^`^^^^]]]]]]]]_^^]^]]\]\\\[\[\Z^ZZZ[[\[[Y[ZZ[YYXXWYYZZZ[XZY[ZZYYZXYZZXZ[XXZYYYZ[ZZZ[ZZZYZYYZZ[X[ZZ[[[\\\\[]]Z[\]]^\]\^\]^]\_\]\^^\]^^[^]^_`__^aaaa``_`a_````a`a``ac``a`baab`abbaccbdbddbedcdcbdccdccbdccccbcccdbcccbabdbceeeeeefeefddeeefeeedeeeeeeffeffeeeeeeffgghhfhiihkiihkllljmmnnnnnpqqprwtromllkjfefffddec_aaab_```^^^^_^^^`]]\]]]]]]^]]\]\^]\]\\\]]Z[\]\\[\Z[\][[[[XYZXYZZYZZ[[ZZZ\XYYZYZZZYYYZZZZYZZZZZ[ZZZ[ZYZYZ[YYZZ[[[[[]\^][\\\^^]\\]^]_^\_``]a_^^_^^_]]^^_`^`b`b`a````````````aa`baa``b``b`abbbbcddeddcdcecccdcbcccbacdbdbba`dddddddbceefeeeeeedgdgdfdeedeefeddeeefeefefefggfgffgfhhghhkkijjikllmmnmmmqoopqqq~urpqollkifffffdddab```_`_`_^^^^^]^_^^]\]]]]^_^]]\^]\[]_\\^^^[\][[[\\\[[][ZZZYYXYYZZ[[[[[ZZZ[Z[YYYYY[Z[XZZYYZZYZZZZ[Z[Y[YZZZZZ\[[[[\]\[\\]][^^^]^^_^_^^^]_`_^^]_^^_^^_]^]^__``_```a``a```aa```aa`````a`caaabcadcdccbddddcdcdcbccacccccccbbccedccbbcddedbeeeeedeeeeegfeeeeefefeeedeeedfefeeffffhhhghgiighjjjjjkklllnnnoooopqqtÿſyuqqnmnlmkjigiffddcb_b`_^^`_^^__^^]^^_]]^_^]_^_]^_`]\^_^\\\]]\[]^[[[\[[[[ZZZZZZZZZ[YYZZY[[[Y[ZZYZ[ZYXYXY[[ZZ[[ZZZZZ[Y\ZZYZ[ZZZ[[[[[[\]\\^\\\[\]^_^]][_^_]^^^^]^`]]^]]]]]^^b^```a`aaa`````a``a``aa`c`b`bacb`bbdbbbbdcddddcbcddfbdbecccdcccbabcddedeededceeeeffeeeeedeeedeefeeedeedeeeeffeggggggghhgghhihkjjhikjljklknlnnoopqpqyusrqonmkkigegfccbbc`_b______^^^_^_a_^]^`_]]^__]^]__\]\]\\\\\\\\[[\[\[[[[[Y[[YZYYZZ\ZZZ[[YZ\[Z[ZXZZZ[YZ[ZZZZYZZZZZZ[Z[ZZ[YZZYY[[\]\\\]]]]]^_^]]]^]^^__\\\]]____^`^^]^______a`baaa````a`baa`a`a`a``aaaabbbbabcccdddcdddddcccccdbbcbabccccddedeceecdddeedcfffedfeddfeededdeeeeefgeeeeeeffegffhhghggghjiihjhhjhiijnlljnnlppopprtÿ¿yxsqrplnonihhhfecccba_`a_`____]_^^^^_^^^^``^]^^]]^^]\]]]\\]\]\\\\[[[[\[[[[[[XZZYY[Z[ZZ[[[[[[[[[Y[YZZZZZZ[[[\ZZ[Z[Z[[ZZZZ\[Z\\[[\[\]\][\\^]\\]^]]^_^__]]]^``___]_^_]_^__]_a`_abaa```````aa`a``b`aaaaba`bbaababcdbecfdcedbdcceebddbcdccdbbdddccbcdceeeceeefefefdefddeeddeedeeefeeeeeeeffeffggihiggjhghhiiihiiiijkmlklmmmnpqpqqo{vuqrpmnmnlhihiebcbcabc``a_``_^_`_^]^____`^_]_^_^^^^^]\^^\]\_]\]]][\[\[\ZZ[Y[Z[YZZ[[[Z[[Z[\[ZZZYYXYZZYZZZZZ[[Z[Z[Z[ZZ\][Z[Z[[[[\\[[]\]^\]]]_\_^_^^__]_^^_^_`_``_^`a_`]____````a`bbaa``acb`abaa`aaabaaabaaabbdadddcbefecccdeedcbdccdbbadcdbccbddcddeddeeedeeeegeeddddddceeeeddeeeeeffgefgfghhhghhhigjijiihijiijkkmnnllonoonqnp~|yvqpqpnmkkiiihedbcaaaa_b_______^]]^^_^_^_]`^_]`]^^_`]``^\]^^]]]^\]\[[\[\[[Z[Z[\Z[\ZZ[[Z[Z\[Z[[Z[\\ZZZZZZ[Z[[ZZZZZZ[[Z\[]\[Z[\\\\\]\_]]]]]]]]\_^__]^^^^^^^___`^_^^^`__`^````a``_aa``b`b_a`a``a_``bbabcbbbbccbddedeedcdddcbddcedbdcdccdabccbcccdbbdcdeeeeeeeeeeeecdedeedfdedeefeeefegfeffgfhgihhhihjjjghiiiiljkjkllknmnonpqnrqÿ}{yrqrpoopkkihgeddbb``ab_____^`__]^^^____`a`__`^]^___^___]^^^\]\^]\[[[[[[[[\[\\\[[]Y\[[\\ZZ[[[[Z[YZ[\Z[ZZ[ZZ[ZZ[[Z[[[\\[[\\][\]\\\]\\]\^^^]_]^]^`_____^_^_`^_^]_^^`___`_````a`aaaaaaa`a````aaa`abab`bbcbcacdfdddecdedddcdcceedceebbddabdcdbeedceceeeedeeeeeefeeeedeeddedeeeefeefeefeefgfghfhhjgfhijihiijjhikkjjjkllmnmnoomqoozztrrpmmnjihhhedbab`a_``_^_^___^_^^_`__``a^```_`^__^^]_`_\\^]\\]\\\\[Z[[Z\[[[[\\ZZ[[[[Z[[ZZ[[[[ZZZ[\Z[Z[[ZZZZZ[[Z[[\[[\^\[\\[]]^]\[^^\]___^^]^[^^^_^____``^_```_`aa`_````aaab`a`_a``````````b``acaababcccdcbecdcddedddddeddcccdccccdcdddbbdcdddeeeeecdddeefeeeeddeddeeedeeecfdeeeeefffhghghihhhijikihjmlkjijjkklmknmpoooooon¿¿~zzwsuqomlljhhgfeebaaa``ab_`b_^`_`___a`__``_``a^^]_`]__]]]]\\\\\\]\\\[[[[[[\[\][Z\[[ZZZZ[[[\[[[\[[[[\ZZZY[[ZZZZ[[[\\\\][]]]^\]_\]\]^]`_]]^\_^a^``^^_^___^^_`____a___ab```aaaa`aa````a`abb``a`aba`cccbabadbcccddddcdccdeecddfedecdddcecccbedcdedcceddefeddeehfeeeeeeddedddededefefeeeefhhgghhhhhhfhjkgiijihjkjkkkllmlnlonnnooo¾~|wuusrpmmnljhfeecccbac`baa``_`^`aa__```_`__`^__^_`___]_^^\\\\\\\\\\]\[[[[[[\\\[\\[\][ZZZ[Z\Z[[[[[\[ZZ[Z[[[[[Z\\\[\[Z][Z\]]^]^^[^]\]]\^_^^__]_^_`_^_a^`_^_`_^`______`ab``aa```b`a`a``a`aa````b`aaabbcadddededdddccceeddedddcdcdeecedacdbcbbebccdeeeccdcddefeefdeeedeeedddcedeeeeeeeefigfhjfiiihhiijihiiijkjjkilikmlmmnmopmmqo»þ}yxwvronppohifgedd`ba`aac`_b_`_`aaaa^``__^`a`_a__]a__]`_]\]]]\\\\^\\\\[[[Z[\]]]]\\Z[[ZZZZ\[Y[[[[\[[[[[YZY[Z[[[[[[\[[Z\]]\\]^^]\^]\]]_^\^^___`]``_^^^^```__``_`_``a`aadb``a`a`aba``b``````baaa`dabbabcbcdcccaeddcddcceebdccdddecddcdadccedddccedddedbdedddeeeefeeedededeedeeedeedeffgeggggghghiiijijiijiijjkkkkjlklklnnmopnonÿ{wwwtqptqnkiggfddeca`abb`ab___a``a``a`````__`a`___`_`_^]]^^\\]\\\^]\\\[]\][]\\\[\]\[[[[[[[Z[ZZ[[[\\\ZY\Z[[[[[[\][]\\\\]]`^`____^]\\^^_^``__^^^^_^]`a_`^_a^^`_`a``_baaab``ab`a`_aa`aa``a``baabaaa`aaadbbccebeeedcdddddcddeddeedecbcbbdacddeeedeeddddddcdededeeeedeefeedfdeeeeeegeeegheigghhiigijhijiijjjkkkjjkjjkklmmnmomonp¿ûyxxxtrqqnlihfedcaa`abb`abaa`a_baaabc```aaad``a`_`_`__^^^^]^\]\\\\\[\\[\\\^[]\\\\\[\\\[\[\ZZ\[[[[\\[\\\\Z[ZY[[[\][[]^]^^^]_^^^]_]]]^^^`____^]____`]^^^`__`_```_aabbbabaa```a`a`a`aa`aac_`ac`ccabbccadcebecceddddeedcddcddeecdddeeedddbcdcdbdeedcdddcdcdddfeeeeeeeeeefeefdfddeeeeffffgfgfihikilkjiijijjkjjjkkkllllmommnloponzvvrrqnlkiggddcccbbaacabadaa`bb``acbaa`ca__aa^```__`^]_^]\]\\\\\\]]\^^\\\\]\\\\\]\\\[\\[Z\[\][[[\\[[ZZ\ZZZ\Y[\\]]`^^^__^___^_`]]__\__a__`___^`]^___`^_`^___````aaabaab`_abaa``````a`aab`acc`bb`bdcdebbddcedddccdddebdddccddfdcdcbccddefdeeeedcdccddeddeeddfeeeeeeeddeeefeefggefghfgihghhhihkjgjiljjijjjklikkkklkmmnmmmpmmĽxwrqomkkjhfedddddabccabccccbcbabbcb`aabb``bbbaaa__^`^^^]]\\]\]\\\]]^^]]]][]\]\]\[]]][\[\Z\\\\[[[\\\[\[[Z[\\[[^\^]^_^^_]^`\___^^^]__`^`^\_______^___`_a`_`__b`baaaabaaaa`ab`a`````aa`aaaa`bacbaddcccdcccddcddecdddcdcdddcceeecdcdddceddffddcdbdcdcbdedeedeefeeeeedeeeeddeehhgfggiggfihhjhihhikkijkkjkikjkklkmmllmmnonomnoxvqnollkjhhfecdecbdcbcacbdbcbbbbaacaac_baaaaaba`_``__]]^]\]\\]\]\\^]]]^\]][]\][\\]Z]]\[[\[[\Z[[[\\\[Z\\\[\[\Z]\^]]_^__]]____]^^__^_^a_^___^]`^``___`^__``ababb`abaacaaa`a`aaaaab`aa`bacab`aacddbdcccdddbeddedeceddddedcddcddcddbceedffeeceeddccdeedeeddceeecdfdededfeegedfefhgfgfggihjjkhkljjhjkiikijkkkkllljjlmnmmnnnmm¿}srpnoljjjieebcdcbccccbdcccbbbbaccbcbbaabdccb`ab__a^__^^]^^\\][\\]^^^^\^\]\[\]]]]]]\\\[Z\[\[Z[[[\\[[Z[\\[\[\\]\^^_]`\]^______^`_]_^^a_^^__``^___`__b`_``a`a_aba_bcb`aba``caba``aaabaabaaacabbddcdddddddcdddeeeedddcccddddeeeddddddddeeeeeeedddcdbddeedeeddedeedfdeefefdddggefgfhgihhjihijjgkjjijikjjjjkkmkmnkmlnlkmmnnnoĿ¿¾zurpmnljiihgedddcccecccbdceccdcccbdccddcaaccb`baa_`___^^]]]^\\^\_^^^^]]\]^\\]\\][]]\\]\\[Z\[\]\[[\\][[\][[[\]]^_]^^^\_^^_^_^```]^^___`^__`______`a_``_`aa`a```a`aba`aa`aa`bbaaaa`b`a`aaba`ccccccbcddeddbdcbdcededddbcecccdddbcdcddedeeddfeebcdcdbcddddbdeddcefdeeeedeeeeffgggghgffhgghjjhjijhkiijiklkkjkkkllllnmlnnlnnnn¿xtqrooljihgfeddccdbbeecdcedceeddededdcedbfcdbbcaca``_`^^]^]^\]]]]]^]_^]]^]\]]]]]]\\]]\[\\\[\\[[[]\\\[\[[\\]_]]^_^]^]]`___]]_^^_^^^`_^^^`^```_`_`_``^`_``aaaaaaa`aaab``bb``a`````ab`b`ababbacacdcdebdcedddeddcdbccdcddccddaddddedcedeeefeedcddddcbecddddcdcdcdecbdeeeeffieeghffghgiggjjhigijiijjjijjjjjjkmkjkknlnmlnnmonn}rrpnnnjhhgfgfccdcddedcddeddeeeddcfeddeedcbdbcd`ba_a__^]_^_]^\]^]^^]^^^^]\]\]]\]\]^]]\][[\\[\[\[\[\\\\\]\]\^^^]^^^^___^]__^__``_^]___`_^``]``______^_`a_``aab`aaa`dabbaaa`aaaa`aaa``cbbbbbbdddccddbdcbbddcdcccceeecddcaabbccbdcbeeddeecedccddcdecceedcedcdceeeddecddedeggggfgghfgfgihhihjlhjjjijikkkkllkjmjmmlmnmmmoonom|ssqppklhhhhffgedeeddgfeeddedfeeedddeeddeebdcdbbca__`^^]]^^]]]]^^__^^__^]]^]]]]]^[\]]^\]^\[\\\[][[[\]\\^^^\^___]__]`^`^_`^__``a`__b_^_^`_`_`__`___^__``aa`caa`baa`a`aaaaaba_`_`aabaaacb`acbdddddddcdbdcbedddddeedbddcecdcdcceccdcdccddgddeeebeeddedcededcddddeeeddefddffdgfffhifggghiiihhihjiighiiiklklmmllmmmmomllnmoop{wsqqnokihgggfeefedeeeefffffeefeefeddeddeedcbcbdbba___]]]^_^^________^]]^^]_]^]]\\]\]]\]\]\Z\[\^[\]\\\]]]___^_^_^^__^`^^^]`_`____`____^^__`___^``____`a_````_`aa``aaaaaaaaa`aa`abbbabbbbbcebbdddddccddbbbdbcbbcdcebddbdbabbdbeeebedbdccedceeddedddcdccddccdceddeeeeeffgfgffggghhghgfhhiiihijjjkjijkkjhmljjnlkmlnnnnnmonoytrrojkjghhfffefeedffgggfefffgfgfeggfffgfgeccbba`bba^_^]]^]`^_^^^^]]__^_^]__^]]^_^]]]_][^\\\\[\\]\\]^\\`__``_``^_^_`_^^]]_`a^``__`_]^_^`_^`^`_`_^__`^``_`aab``aa`a`aaaa`baa`a``aaabaaccdcdceddcccdcddccbcddecdbdbdbdadcbccbebbebdbeddedccbdecdcefcdddbddddebdedddeeffhffehgfgggghghiiihhjjiiijljjklikllmlmmnmooknnnpqno¾zvspolkjhgkgfefeedfegfghgfiefghhighfgfeeefdcdccbcb`_`__`_^__a```_^]_^_^^_^^^^]]^\^]]_^^^]]][\\\\\\\]^^`^_`b```b__`__a^^`_a]__a_b_b__a`_^_^^_^`^`_^`_`a``__^`ba````a``a`aabaa```bcb`bbcbbccbcccdbcaebccccdeabcebbcbdeccdcbbdbecccedecddedddcedbeddedccdcdbedcceefeedeegfgfegffeffegggiijihkjkkjijllljmnklnlmmnmmnonmnonnzsrpnlkihgfgeffggfgffgghhihihhiighihhfgggfeedbdbbcab`___````_`____^^_^__`_^^_^^__\]]]]]]\[\\\\\][\]_]^_]`bb`a``___^``_```_`_____``a__^^^^^`^^^__^__a`^`_^_`^_`^``a_aaa`abbba`aaaaaabbbbdcccdccbcddbdcdcbcccdcabcdbbdcba`bbccedddbccdceecdfedcddddeedcecdecddeeeceffgffgffffhfffggjhhhhgjkkkjhkkkilikmllommmmnonnnooopqo{wsqomkliiigghgfghffegghhhghjiigiiihhhhhffffeddcdbcb`a``a^__`_a_`_a_^^^_^`___^^^]]]^]]^]]]]^\][\\[\^^]__a`ca``_`a`aa`___``a`____a`^``_`_a^^___^`^__a_]^`^]^^^^^_`````aaabbbdb`c`acababcdbacdecbdbcccabddccbada`bdbcabbbbcccdcddccdddbddddcedddddefcebedceedcddccfefegffffffffgfgggghhgijgkjkkkjlklijmlmknmnoomnoonnnqpnpzwsqnomkihihggggffghggfggkiikjjjjjjjijihggfgedccbcbb`bca```_`a`_a_`___``^__^___^]\\^^^^]]]^^]^[\]\]^_^^__aacba_``_`^`a^`__a^`_`a_^^`_``_^_`______^`___^`\^_^_^^^_^`a````a`ab`b`acaaabdccdbbbbbcbbbbbcdbbcbbbaccbabcabdbdccdbbdeddfddeddeedcedecdcdedcddeedcedeeefegfffgeffffgfffghgihgjihjjjjiljjmlnllnnmmnolmpmoompppro{xtsponlkikjhhhggfhhfhgfgghgikjjkjkihjkihigfeeeebbbcbab_aa````aa`^`a``^_```^^_^`__^^]]]]^^]_`_^]\\^^^]^_^__bb`b``__a``__a`aa`_`_a_``_`^`_^___^__^__`_^]^^_]\]_\]^`_```aaaabbaaabaabbbbbbacabccbcbabdabdabbbccccdabccbddcbccdddecddddddeddeddddededecedeeeeeeeeeecfgfgfffghfffgghgfhfhhiiiijkkkjmilmojmnlnnpoolrnpqppqorqp¿¿{wurrmmnjjhhhiggfgghfhghhiiiijjjkljkijihjhggeeeddcccd`baaab`aa`aab_b_ba_^_`a`__^`_]\]]\_^^^^^]^^]^_]_]^_^a_aba``a``^^`__`a_a`^``__b_aa`a^___^_^_^^__]^]]]]\^_`]]__^``aa``abbbababaabccbbcbdbcbbcbbdaaacabbaaaabbcbcbaabcbbeeddddceeecddeedddefcddeegddeedeedefedeggffffggggegggfffhghjihkijjikkjmmlmonknmnlonoonpoqpoqqnp¿}zvssrnmnjjiiihigffghhghihjhijhkjjkjjhjkihihhfeeeeebcccbbaababaaaba```aaa``___`__]`^^_^]__^^_^^^]^_]]]^^_``aa_`c`ba_``_``_a_``^\__^__`_``__^^]^^^^^_\^^\]]\[]\]^^^^``a``aaabbaabbbcbbbcadbcbc`cdbbabb`bbbbdbbcbdbbbbbdbcbacbdeddfdebeeeecdedeeeeeeccdefdeedeefeeeecggfghgghffffghfhhgighjiiijkkmllmonmllnnonmoooopnoqppqpqzuusomlmjjkihhfihgghhihihjiijjijjjijijjiighffedffeddccbcbabbbbab``a`_b````a^_`_^___`_^^_^___]^]]]^]]]^]`_a``bab`aa``a_``_`__`b_```_a^``___^^]^]_^_]_]]]]_\]]]]_^__a`_`^a`abbababaccbacaccebbbbacbbabbcbbccacbabbbdabcbddddedffddedeeedcdeeddeddedededfcedecedefcffgffffhfffgfghgghfghgjgiijijjjimnlmkmmmmnnnopopnpnpoqpnqyyutspmlkmikigiiihhgiiijjkljiiiiijjjjihihihhgefeefdcdccbbcdbbab`b`a_```ab_^___```b__`^^_`]]`^^^]_^_^`^^`^b`_aaabb```___`_a_``]`]`^__a__`^_^]^][^^]]][\\\\\\]^^^_^]`_`__aaaa`acabbccbabdacacccaacbbbbbbabccacbbcbbcbbccccdfdcedeeefeeeceeedeeeecedefgdeedfefeefehhffffggegfgfgfhheghfjgjjijkjjkjmjmlkllolnnnnnnpppoppqoprryxusrrpmkjkiiiiiihhhiijkkjjmkjijjiijhiihihgffefgeececdacacacccbaaad`aaa```^``_^`ab^``_^^]^]_]`]`___`^`_^^a_``ba`aaab`````a_``___`____`^`^^^^_\^^\]]^_^]\]]^\]`^^__^_a_a```b_``ccbbccbada`bebbabdbbabc`bccadbcbccbcdadbedceeeefgeedeeeeefeddedededfeefdefeeffdgfffggggffhghgfghghhhgghijhjjjjjlljkmllnkolmomnpppnooopqrrsp¿~yywvsppnllmjjiiiijkjkkjkkkmmmkhijjijjjkijhhhigfgfeeeddbdcccdbdcabbad`abaa`a```b````^`_^_^^^_`^__^^`_``_`^_``a`bbacaaa_`^aa`_]_^^`^^^^^___^`^^]]\]]^]^\]\[]\^\`_]^]___^__`_``aaabbccccbbcabccbbcabbacbbbccdbbbcbacdccedddeeeeeedeededfeeeeefeeeeefeeedgfegeeffgefgfhggfgfhhfghfhffihgghhiiihijjnjlkknknkonmomnnppnnoorpqrs~zyutrrqpmjlkjikjikjlmmmnmmnmllhkjikjikjhjhhhhhgffgfgeededbbccedbabaaaaaaa^baa_`aa``a`__^^__^]_^_^^`^`^__````babaa`aaaa```_^`_``_`_^``^^`^_]_]^]]]\[\[\]^]][]_^]_^_^^^^]____^abbbbaccacbcccbbdbccabbbbcbcbcdcdbdfbbbacbdeeeedeedefdfeeeeeedeeedfedefeeeedgfefggefgfheffggfggghgggghhgiigjjjkiikhlklmmknllmmnnnnoppqosqsqquÿ¾~|yvvsrsplkmlkjijlkmllmnoononmmmijiijjjjhjihihghffffeedddccdeddebabbc`cb_ab`ca`a```````_b_^`_^^^__`__a`^^`aab``c`bbabaaa``_a^_]__`^_^_^^^_^^]^]]\\\\\\[]]]\]^\\]]^^\]\^]`]^^`abaaaccccdaddabdbccbbaaabaabbdcccbcdbcbaecddedddddeeceeeeeeffdefefeeedfeeeeeefffggihgghfhghggigggghihihgigijkjjkjkhkkmkjnmmmlmmmnnpooroqppoqr¿¾zxvusropnnmljlmjmkkmmnmpqqnnlljjhjjjjjkljhjjggfghgffefeedeedceddddabbbccbbbaaab````_`^__a__`a`__`_a_``````bbbabbcabbab`a^`b^^_`_`__`___`^^``^]]\][\\\]]\]]\]\^^^]^]]\]^^^___`bcacccbcecbbdcabcbabccabcccbbbbccccbcecaeeeeeeffdeefeeeddfdeeeefdeeeeeeeedeeggffgggghggghfghhgghhghjjhiijiijlijijjllkmmknmlmnnnnpoqoppqrpqsq¿|xututsspnlnmmmomnlnooqorqpolllklkkkklkkkikjijjigggfeeeefddedddddcdbabcccbbba`````a`aa_`_``^^___a`a`abc`ab```abb`bbaaaaba`____^_]^_^^]_^]_]\\]^\[\\[][]\[]\[\\]]^]]]]^\]]]__aabbabcbaccbacbbcbbbabbaabcbbbdbccbdbddeeeeeeeefeeedeefeeeefeeffffeffefgfeeffghgghhighhggjgigihihgijjghjjiihhkkjklkkkkklllkmklnmmnnooopoqpqruÿ½~ywvutusronmnnollknmpnppqrrqolkljljjjljjinllijhgggigfefeeeghdddeceebccbdbbccbba`caa`ba__a``a_a``a`_``_`_babb`abbcaacab`a``__^___`^^^_^^]^]]_]]]^[\]\\\[\\][\\\]^]]]\^]]]]_^``aa`abbccccbdbabcbbbbbcbbbcedcbcbddcdddeedfdfddeeeefffefceeededfefedeeeeeeffffhgfgihfgghghihghfihjhgigjhjhijijhilijkkklnmklnkomnnonpppppqorqrv|{ywvuvusrqqomqnnqopprstsqrromkmkjljmmkllmkkhjjiiiigefffggfefeeeededfbdbccccbcbbcbaba`cbabbca`aba`b`baa_b`aabbbcaaaaba```_^^^_^^^]^^\^]_^^^^_^]]][\[[[\\\^\\\]]\\^__^^^]^\_^`aacaabcbbcccbbbacacbbcbccceacbcbbccccceeeefdededefeefddeefdfeeeeeeefefeggeefhhgghfggfhfgjghiiighiihhjiiijikjkjjjknnkkmllmlmmnlmnnnonoooqqqsqq|{y{xxyvttsssrspqqpqrrqpqqsrnonmkklmlllklmmnijiiihihhffggfffgffefeedfcbdcccbdceccbdaabb`abccaaababb_aabacdca`acdcabaa`````a^^_^^\\\]]]^^]^]_]]\\]][[[\\[\]]]]\[\]^_^^]^^_\_`a`baabbacbcbbdbabcacbcacacdcccbedacdeeeeeedeeeeeeeedfffegdefdeeeefeedegegfhffhhhggihggijhjiihgghhhhhiiijkjijjkklmlklnllmlnmmmmnmloooqqpqqqtqqs}|}|zzyxwwvuvutssrqrtsrrsrqrqqnolkllnmllmlkkljijiihihhhghhhigggefeeeecdcbccddbeecba`bbbbaabacbaa``baaabba`ba``_``a`^b`^^__^]\]^^\\]]^]\_\]\^]^]]_]\][[\\\\\\[\[][]]_^_^^^`a`aabaacabccdbcbdcabcbdccb`aadbbcdcceecdeeddeeeefeeeeeeeeeedfeeeeefeefeeefgjfgijgiiihhhhiijihihhhijhijjhgliihmlmlmjkjkkmnmnmmknmllmnonppnpqqqrrr}|~{{{{{|zzxvvuvsstssrtsqrqponmllnopolljlnkjmikiihiihhjhhhghfgheefdeeedbcaebdddddbbbcccababcbcda`bbcaccaaaa`_```_`^__]_`_]^]^\\\\\^__]^]]_\]]\]]]]][[[[\\[\\\[][]^^]^_^`aaabbbbbacacccbbbdbbbcbab`bdabadacdddcdfedefddeefdfdeeeeffefdeeeeeeeeeeeeeggfihgihikjihjiihjgiihhhjijgiiihjimlkjkjklkmlmlmllmnmnmnnmpnnpnqppoorst¿}}}}}zzz{xzzwywxttttuttrrqqqppnnnnmloomolnlmmkliiikjlkmjhihijhhgfgeeefdedcceddcccddcababaaccbabbbbcababaaabba^^_`^```_^^]]]]]^]\\\\^]^_^^^\_\]\]\\\][[[[\\[[[]\[\]\^\^^^_baaaaa_abb`cbcccbbcccbacdcbcbbacbbdbededeedeeededfdfegeeffdfeefeeeefeeeeeeegihgiiijijijggjijhjhijjiikkjjkjlhkkmklkmmkllmllmmlllllnnmnnoooropqosqt¿~}}{|z{yzyxwxxvuttstrsrrsqooooolnoololmmmnlmljiliklliljjliljghhegeffeeddddcbcdcdcccbbbdbcdccbcbcabdccaab`a`b`_]`^_^^^^_]]]]]]\\\^^^]]^]]\]]]]]]^\]\]\\[\\\[\\\[[^\]]_^a`a_aa`aabcbbabbdbbbbccababdbcacbacccedcedeegdffeefcdeeeefefdefeeeedefgfefffhgihijiihikiikijihijigihijjjkkjkkkljkjlkmmlmnmnnmlmlmlmommoonpopqqrpqr~~|~|{y{zwwwvuuvuuttssrrqmqopmmnnmmnnnjmmmnklklnjnllnkmnlllihhhhegedefedcececcdbdbccbbbcccbcdbdcbbb`baaab_^``^_]a^^^_^^]]]^^]\\_^_]]]_]^^\]^]]\\\\\[\[[\[[\\[\\\[[\]]`aa__`ab_a`aaab``babdddaacdbebcbacbbdccdeeeddefddeeeedeeefeeeedeeeedfeeffeffgihhiijiijjjjkjhkihijhjghiiijkjljmiillmjllklnlnnmlknmkmonmlomnnnpnqpqpq~|||yyyyvvtuvutvsrsrrssononlnnnmpmmlnlommmponnlnjllnnmljhhgehegfeeeeddccddeecbbdbccacebdceecacbaabb`_aa`_^^^^_]_^]]\]^^]]^]]^^_^^]]^]]]]^\\]\\\\\\[\[[[[]\Z[]]\[^]__^_^`a^`ab`a_aaabacdebccbdbcccbcbceeeededeeeeeeeefefdefefeeefefeeffeegffhgjhhjjijhhkjijhjjjjijkkkjiillhllllijlmmmmkmlnmmmlmmlnnlnonmomlooompprpqr}~|{xzzvvwtuuutuvsssrssrrpoonoqppnlmmoonpnppoppmlmomoolklijhghefgeefeefeccddcdceeecbcdccdcddbcabbab`_a^^`^^]^]]]]]_\_]]^]]_^^__^^]]\^]]]]]]\]\\\[\[[Z[Z[[[[\[[\\]\]^]^^_^__`__`_a`aababccdcacabacbbaccceeeeedeedeefdeedeefeeeefefdfefeeefgffhhghihijkijijjkjihiihiijjijjkkkjkmjklmmnmlmomknmnplnnnmnmnmomoomonnppqqrq}||wvwvwxvtuuuuuutsssssqopopnoonoomoqnopnnopooomoonnnnnljjihghgfeeegfdfeefedfddeddebcdddddddb``a_a___``^^_^]]]]]]]]]]]\]_``__]^]_\\\^]]]]\\][\]\\\[ZZ[[[\[Z[][[]^]^^^]^]]`_^_`^`_^`abbbbcccbdbccccdbeedeeededeeefeeeegeffefefefgfeeeefggehhijighjhihjklkjjjkjiijjiijhjjlklillmnllnlmnmnmnnmonmmnnomonomoonnqoopqqpqr~~||{vvwwuuututxtutrsrrsrqppnnpopnmnnonpqomoopqopmnnlnmliihhhhfggffefggefecdeeeeeeeeeedddddabad```_`b^^^^_^]]\]\\]]]\]]]]`__^^^_]]\\]]\\[]\\\]\\\\\\[\[Y[[Z\[\\]\]^]]]]]_\_^`__`_``_bbcaabccbccadcbcbbecdffdeceeddedeeeeffdefeffefeegffggegghhhiijiiihkkjkkijjjjkhiijjjkjllklnonmonmmmnmnmlmnmlnnmnmmnonmpronpqqopsrq¿¿}|zwvvvwwwuvvvuuuttssstsqpnpppoonononnqomoqqonnoomlmlnmihihggfgffffgggdffddefddfefeebdccbbbbaba^_^^`^^`]_^^\]]]\]]]]]^^_^]^^]_^__]^][]\\\]]]]\\]\][\Z[Z[ZZZ[\\]^]^^^_]_]_`__^```_`a`caabcddcaccceddedddeeecdbdeefedeffedfefefeffffgeghhgihiijikihiikkkkikkljjkljjjijkjkllnlmnmllmmnnnpmmomnnooomnnnnoopnooporqprorr}{ywvwxxwxuvuvuutuussttssrnpqqopooooponmnnnpoorponlmkkjhhhhhhgghggfggggfddfeffefffgeccdbbbcaaaa__^^__^]^_^^]\[\][]]\^^]__`_`]^]^]]\\\\]\\\[[\\\\\\[[[[[ZZ[]\]]]^^]]]]]_^_^^_^_^^_aa`abccbddccadcdedeededddddefedeeeeeeefffeeeffdgghfghiihiihhjjjkhjjjjkkliljjiijjjjljijklknmmmlmmnnnmnnnnpnnoononnmoonnopopqqrqrqrq¾{xyxwyvvvvwxvuvtuutttuqsqspqpoomnnmnoooonnnoopoopnimkkjijggihghgfggggggffeeeeefehfeedbbbaaada_a`_`^_\]^_^_^]]]\\]\]^^_`__`___^^]]\]\\\]\\\\\[\\\[\\[[\[[Z[\]\]]]]^]^^^]^^^^_^^_`_a_a`abcdbddcbeefedeeeeeecfeeeeedeeeeefeeeegeegegfhejhjighjjijikkljkhjmlkkjijkkjikjlklmnnmmnmnnnmmmomnponpnnoompononoprorqqqqqqrqrĿywyxwvwxwuwxvvvvvutustsstqopoonopoopnmmmkmmnmoqnonkjmjjkkihhhhhiigghggdghffffffeeddedcbcbaab`a`^^^_^\_^]___]^]]]]^]]__^____^^]\\]]\\\[\[\[\\\\[[\[[\[[][[Z[\]\]]^^^]^^]__^`^^^_^`aaabcdcebcebcdeefeeeedeegbefdedfeeeefffggfeeffgffejhgjiiihjjiklijlijkikkkjjklkjkklmklmlmnnmooonnmnnpnnonoolmonqoooppnrqrrrqqqqtpq½}ywzyxwwvvwxwwtwtuuutussrrpopppppnmomnnoomnnmnnnnlmkmmlmlihjihhihighihhgigfgfffgeedddebaaa`aba``_`^^^^^^]^`^_`_]]]^_^^_^^^^a^_]]\\]\[Z[[\]\\\\\[\\[\[ZZ\Y\[\\]\\]\]]_]^^^^^_^____a`_abb`cccdcebedfdfeefeeeeedeeeedfeeggffeffggfffeghgjhikkjjkkjkkjkkklmlkjjjkjkjjllkjmnnmlmnmnpononmnnonoqonopnnpprnpnrrrprqrsrqrrqzyyyzywxywxxvvwuutvuuttrtrqqrpnqnponooomnppnmooomplnmmnlmkiiimhhijhghhigghhhfffgfefeefbaaa`a`_a`__^_]^^_^^^^^^`]^_^]]^`^^^]`]^_^\]^[\][\\\]\[\\[[\\\^\[[[\][]]\^]]^^]^^^__^^^^___aabcabbcccdcedcedeedeefedeeeefeefeffffefffeffeggfggkilhhiijjklkklkkkkkkkkllkkklljkinllmnnnmolnnonmononnnponoonsoooqqpqqprqpsrsrttr¿½{zxzx{yywzxxxwvwvuuuvuttsroponnoponqonnooppkkmmomqnoppnmnnllmikkiijihkhghhhghfffffeefd`bb``aaa____]^^^^`_^``_^`]]^_^^^^^^]_^^]]]\]]\\\]\\\\\\\\\\\\[\[\Z[]]_\\]\^]]]^]]^___^^^^__`ababaccbceceedecddededeeedeffeedfffeeeffggeggfgihihghhkikjhjjijiklmjkklklkllkkklllnnnmmononpnlomomooponooonnopoqnqpqorrqrrqtqrprs¿}{|zzyzzyyzwywvxxvutvtuvttqrqppnpopnpqpppnomnomlnonoorqqonoonnkkkjkjkkilggighhgffeeeeeddbababa_a``^_^__a`^`_``^_^^_^]_^^]^]]^]^^]^[]\\\\\[[\[\\\\\[\[\\\]\]]]\]]]^\^^_^_]^^^^__^^___`aabbcbccbeeeddceefeedeeeeefedeeeedgffefffefeegfhhjhijjlkjlljlkkkklkkklklljmkllmmoonooonmnnnpqnopoqpopnooonopqprooqqppsrqqrrrssr¿~~|{xy{zwz{yyyxwuwvvwwvvusrrqqrqrpqpoooppppolmmmmmpportrrqpqonnmkjljjjmijgihigggfefdeedecbabc__`_^__^^^^_a``_^^__`^]]]^]]]]]]^]]]^]\\\\\\\\[[\Z[[\[[\[\\\][\]]]^\\^]]]]^^^`^^_a^`_aaaacbbcbaceeeedefffddefeedfeefegefeefffegeggfhgkiijjkkhkkijljkkkljkkkllllkmllmlnmnonpooonmopnnooopnpoononqpqtpqqoppqrqqporrpsrsrt¾Ŀ¿~{z{zy|{yz|z{xxwvwvvvvuuttqrrqprqpqropqoqppmoponppprrrssrrqoomkkjmlmlligjgikgggffffededeab`_aa__^_^^^^^a_```^`____^]]^^]]]]]]]^]]\\[[\\\Z\\[Z[[[[Z\\\[\]\]]\]]]]]]]]_]]`^^___^`^````abbbcbeeeeeeeddedfeedeefeefefdeeeeefhffhggighgiijjijijkjmkjkklkmmmjkmlllmnkmkmnmmnnoonnoonnpooononppnnpoqqmqosrrqrqrpqsptrssrtr¿¿}|{|{{}y||{|{{zwwwxwxxvvstrsssorsqqqppqppnqopooqoonqrqrrrppnnkkljnmmoljihihhigggefdedfdebcca_`__^_^_^]^`b__^`_``__^^]]]^]^]]]]]]]^]\[\\[\[[[\]\\[\[]]]]\^][\]]]]]]^]]]^__^^^^_`__`aaabbbddddedeedfceeeeeeeeefeeegeeefeeefgehhhjjjhhiijhiijjjjkjkmklllmjmllkojonnnmnonnomnonnopoqpoppoooqpqqpoqrpqsqqrrqrrsqrsrrtrrt}}~}}}{zz{z~}z|{z{ywwyvvuvsursttssrsqpqppqpppppppmkoopprnprpmnlklljmmlmillikiighffgceeddccdbaaa`_______^___^^^_____^_]]]]^\^\^\^]\]\]][[\Z[\\\[[\[[\]\]^^[^]]]]]]]]^^]^]^^]_^^____b^ababcbcbecededeeeddeedeeeefefffeeedfgeffffggjihjgiijkhljkkmllmllkmmklllnnmnnnnmnlooonnoponnpopoooponoopqqrqorqrsqqrqsqqrrrtrssurr¿~~}|{|}}}{||{~}zyyyzvwtwtuttsrtssrqqqqrsqrqqrnqkpnnnlnojjkkjkknjmkmkklhihhihgffbdedgddddbc``_]^^__^^^^`^^_`_`__^__]\]]\]\]\]]]]]\\\\[]\\[\\\]]\\]\]^^^_^]]]]^^^]]^]]]]^^^^__^___a_aaadcddecdefdefeddeedefeefefdeeefefefgfgighhjjhjijjkjjkljkkjmklllmmkmlkomolnnnpnoopoonoonnpooopqooopnnmpoqpqrrrrtrssrtusrsqsrqs¿~}}|{x|{~~}}||{zvxvwuuuuttttssqpprssrrponnomomnmlmknkkjlikllmllkljlihgfggfceddceddccbcb`_^___]^___^^__^___^]^_]]]]\[]\[]]]]][^[[\\[\[\\\\[\\]]\]]^]]^]]]^^^]^\]_^`^__^_``_a___b`dddebcedcefefddedddfdegeefefeeffefeefgjgjiiijjjlkkjklkkljkkmmmmkkmlnnonpooonomqppoompqnoopooprpppopqornqprprqrrrrsstrtsutsrtv¿}}z{{{~}~~}|yxuwvvuvvuussusttrrrtrrqppnolnonlljjiihikhilkikjlmlljjigfgggeeeecbcaccda``^^_`^__`__^^`__^^^^^_^^]]]]\[]\[\]]\\\][\Z\\[\\\\\]]]]^^]^_^^]\]^^^^^^]]^^]^`^__^^`a_aaabcccecefceeeefedeeddeeefeeeeeeeefeffehgigihljkjkjjjjkljllmlmkmmlnllnmmnononpnqpooppnonnpqonpooppnonprqqsprqqsssrsrrstrusstttsÿ|}|{{}~~}|xxxvzvvvvvtvsuststttsttsqpnonpomljjjjjhkihijkmjlkllljjhhggggedcecbcecbdaa`___^`_______^_^____^]\]]]\\\][\Z]\\]\[\]\]\]\\\\[\\\_]^`^^]]^^^^]]^^]^_^____^^`_^`_```adbcbddcefdfdddfeeddeeeeeeeeffeeeeegfghgiikigjiijikjjklkljkkmnmmmjmmnnnnoonnppooooqpnqoqppoqppopopnpoporqtrqrsqrsrqrqtstrtsssvt¿ÿ}z~}}~~~}xzxzxwvvxwwwvuvuuuuutuuttrsqnnoonjjljjjiijijjjimlmlmmjlikhfgfffecceccabbaba_^``_`^__^_`_`_^_^]^\]^]]^\[]\\[\\]]]][]]^\[\\\\[\\]^^]^^^^]^^^^^^^]]_]^^^^^^^^`_`^_`ababbecdddecedeffdeedfeeeefdfffffgefgeehggihjjikkjklkkkjlmillillmnmnlnlponopnoppnopooppoopnorooosrprrprpqpqrrprtrrrrrstrstsststrs~||z|~~|zyz{xwwwxwvtxxvuxwvxwxytvuuuuqonmmnmllkjjjhiihiikkkkmlmkhkhjifgegdddbcababbcbab_```__`__`__^^^]]^_^^]_\]]]]]\^\\\]]]\\\\\\\\[\]]_^^^]]^^^^__^^^^^_^^_^_^_`_^`^`_aaaaacddceeeeddedeedfefeeeeedeedeeffgfeggihjkjkjijjhhjkllknkkkllmmonmnponopmopopopmoqoqoqpopppqoooqopoonooroqtrspsrtttsqssssstsstts||||}~||zzzxxxxwwvtvvuvvvxxwz{{xyxwutsqomnnmlljkjkhghhgiiijlklmjlijigghffefeeccbdbecccab`_______^____^^\_^\]]][][[]\]\]]^]\]]]]^]\[\\\]^^_^]^^^^_^^_^^^^_^]_^^^_^_`^_^^````abbbbdcdcdbefegeeefegdeeeeeeeffgeeefeigghigjijiklkklkkmijjllmmnlmmolmnpnoopnnqonpnpppqnoqooppqpqqsoqqqppsqrtotrtqsqtttrssursutrtu¿ÿ~|~||}}|xxxwyxxxvututtvwvwxy~|{zyttttqqnmookkjjkijhihihikjkmmmljhiiigfeefedbccbababcdaba`__`\^]___`^\^]]]^\_^^]]]][\]]]^\][]\]]\]\]][]]^]^^^^^_^^^^`^`__^^_^^]```^^a^```a_bbcdcecfdddeeefffegefeddeeeegfeeggeefhhghiiijjjkklllkllllkklklnmmpmooloopoonoonooppqoqqppqpoqppoqrpooprqrrqqptqsqrssusttrqsrsstrs¿¾~~}z|~~{y|xxxwzxyxwutsuuuvvvyzz{zx{ussrpomlkkijkkijijhghijlkjjkljiihjhfefefdedeaa``bcaba_____]__^____^^^^]]^]]]^^^]]]]\^]]]]]]]^]^]\]^^^^_^]^^^_^^^_^_`___^^^^^a__`^b_`___aaabdcdddeeeeeeefeedffffeeefffggfieegghjihjkjjjjkjklkklmlmkllnlnmoqopooonnoonpnpnpooooooqqpppoprpqppqossrpqrtsqrvrtsrvtrrtstsusstt~|{}{}|yy{zzyvxxwuuttvwwvx|z|zywyusrqoonlllkjjijiiihijjkklmkjhjihhhgffcdefdfcaa`abb````^_^`_^^____^^^^^^^^^_^^_^^]]]]]]]\^]]]^]^^^^]^^^^^^^^_^_^^____`_^^_`a_`^__``aabb`bbacddedeceedfgeegfeffffefefeffggghfiiiigikhkljiljlmmllllmllmlmolmmnnmponpooponooooqppqsoqqqqporqqqqqrpspsoqqsqrrqssrurttqtrrrrrt¿~~}~{}}}}xxx{{zzyywvutuwvwvx{{{yzyvvsurnpmmmllijhijjijjikkkmnjkjihjhhhffgeefeecdcaa``_`_`__]________^_]^]_^^^^^_^a_^^]]^]]^]]]^^]^^^^_^^_^__^___^_^^_^___`^`^```^__a`aabb`bcdcddeddeedeefeffffffffeffegfffheggigfiijkjhikkjmjkjllkmllolnnnonnoopononopnnpnppronoooqpqroqprosssqrrrqrsrqqstsstrrrrpqtrrustts¾}|||}}yz|zz|}yzwwwuuwwvwx}|{{{{{xvttrmqomlkkjijjhjjkkmkmmkmljhhghhefeffdefcffaba``a`a``__`___^___`^__]^^^^___^`_^_^]]]]^]^^^]^]^_`^^^_^__^__^______````^``a^`^`_aababb`badddeddcfeeefefefffffffeefefefejggigghjjijjillkkkkmmlmmlnnmmkmonnnooonnopooppqpppoopqprqprqpprorrprsrqrrrsqsrrrsrtqsqssrrqrvusssÿ}{||~||||}|~{}~zxywwzwwx||{|{{y|zwusrromnlnjkiijjjjllklmlikjkihhfhffdeeddcdecdb`caa``````___^`___`a^__`__``_^``__`_]]^^]]^^]^^^___^^^_^^^^___^^^_`_aa`a_a^`___`ba`abdabcdcdcdeedfdefefeeeeefgfihfgfefegghihhiiiijjijkklkkklnlkllkmllmnmmnpnnonnppooooooqprprppopqrrrqpqorssrqsrsrrsqqrprrssrrrrtrsqrssss¿}~~~~~}~}}}}{{{wwyv|{z{|}{{{{wtsurqlollkkjjkklkkllkljlkkjihggegegdcdcecbdccbcaaaa`a`aa____^^^`_____^___`_`__a_`a^`]]_^^_^_`__``___^`_`__^____`a`_a``ba``aa_aacbacccbbfddcdededffeefgfgffegeggfeffffifghiihhikkkkjjkllmkjlmmlnmmmlnnmnqqnopoonqoopoqqopqqoroopqqppqqqqqsrrqtqssrsrqrtssqsrststtstttrt½ÿ~}~~~~~{||{z{{{yz{{~~}}|xuxwttpnonlklkljklkmlnmlkjkiigfefeedeabacdccedcbebd`aaaba____`^____``^```ab_a_a`baaa___^__^`__`_aa___^____`_^a`aa`aabaaab`a`aaaaabddcbddcfddeffeeeeffffeffgfffffggggggfhjijjhjjkikkjikkklllmklmlnmmommnpooooonnnqpropnppoqqporppopopnporqrqqpqprrrsrrqrrrqsstqsrtrttrsuĿ¿}~}}}|z}|}||{w{}}|{zxuutronommlkklklnmkmkmjjiiggdedeedbbbabaccdecgffcdccaa`a______```_`__``aabb``cadeb`a`_^__`_a`__``_```_a____aaaaa__a_a`aaaa`abccbddeebccbdedbdeeffeffefefhfgfffgggghghfihhhhijjjklllklmlllllkmlkmmnpnnnnppoonoopqoonpoopotpqqpqrppqoqsprrprrrrsspsrrsrtrssrpsrsrttvvvt¾~}~|}~||~}~}{|}||ywxwusqnolplklkmlmlnomojjiigefceeddbaabaaabdeeegedfebcbaa____`_`_```aabcbbbbaacdcdbabcaaa````a^`a`a`aa`b`_a`a``ababbb`b`bbbaaadbcddecdddeffdfeefedffffhfgfffegffegfhgihjjjjhiijhklkmlkmkllmjlnnlmmnopnononoonqopnoooooopopprorrppqnsqqqrqrrprqrrrsqtqqqrsttssssusssttr~~~~~|}}~}}|{zxwwsrspomllnmnlmplmkkjijihfcbccbcdc`_aacbcfffcdfghhdddbb``__``aaaabbbdcdebebddeddcbcccb_`_b_b```b`a_`^`a_ba`bab`_``bbb`dabbceddcccccdddddeefeefffeeffffggffgffigfgfighijkijkljkjllklkklkkklkmmmmnmpmnnpopqnqompoooooopsqponqorpnoqqrqqorrrqrrtsrtqrrsqrqrqsrprrrrturÿ¿}}~~}~||{zzxywutsqomnnmlpoonmkkjiifgedddcbfbbbaaaacbccedcdggffcdccab`a``ab_abccddfeeedcdedddcecbc`aaaa`ababc_abaaababbbcbcb`caccbcbacbbcbdcbfcfddedefefffegfggfffghggighihijhkjiigikjijkjkkklkmknkmmjmlmmnononnoppopoqqpopoqqpnqooonorqpoopsprqpqsqrqprrqrqrqrqrqsrtrsrrrusstsþ¿~~~}~~~~~x{{|{zwturonnmoonqmnmlkkihgfecccdbbcbbbbbabbbccdcbeeeedddbdbdaaa_ababdecefhfeeddfdefededc`caa`a`aacccabaa`acacbadabbbcacaccddfcbccdcdcfdeefffefffffefgfgffffhhhgjijjiliiiiijiijklhkkkkllllnlmlmooomonmoompoopnmpppnonpqqopqpponqqrprpqqqqpqqqpsrrrrrpqqrrqrrrrqrrstsss}~}}{|~}{{|~|||xvstqppnpppnomkliiiggddcececbbcbbabadbcacccdabcbbcbbcdaaaaa`ababcfeehkhfffedddefcdcbba`bbbcbbbccbbbcccbbccbbcddcbbacaeddcecdceedeeceffffeffffffegfgfggggfhhigjihijiijihjjhjjkknjlllmkllkmkmonooooonnoopnnnoppqpoppoompoppqqsrrrrqrrprqpsqqqrqpqqqqprrrqrqsrqtrttÿ¿~~~||}{~{z|~~}{}}~ywvtsqqpppqpmokkjihfgfecdbbbbbcdccbaaacbbbbbbabbababcbb`a````baddggihjhgffgfedgfeccbeccaacccdeeecdcbbdccdcdcccbcdcccedfdedeceeefeeefddegefffffffhghggfgfhjihjkjiiijiikkjklkkjlllllkmlnolloponpnooonnonooppponnonppqoopppproroqorprqqpqqqqprrqrsqqrqqqqrqtqqsrrts¿}{|{{||zz|~~~|}|~|xvvtqqspppplnklkjifhdfddeecbbcbcadbadbbbccbc``caaabaac`baa```acddfejhfjhihihggffeddcccccbbcdeddcecdccddceeccbbbcccceddeecfdeeeeffdgfeeffffffffgfhhffgfhjiiiikjkjkijjjikjijjlikkmklklllmlnnnnoonooqonnoqoooooppppsorpoopqppqoqqrprprrrrpsroqqqprpsqqqqroqqsqrqppt~{z{{zz{z}||~}ytuqprsqrookmkjijgigdfcceeecbbdcdbbabbbbbabcaaaaaaaacacb``ab`bcceefghghggikhihfffeccedcccdedeecdfceddddecddcccddddffffeefefffeefedfeeeffffefffgffggghhgijiijiijhjijjhiikkkimlkjklkmkmlnmnomononolnnloooonnropooopoonppoqoqqsopqppoqpppqqorppqqqpppqqrpqqqrsqrtqs¿¾~}~yy}yz|{|}~~yvuqsqqqqommmkjihhhigffeeeedcdbdcdcbcbbbbabcbbaaaaaaaaaa```__`bccdffeghjkikkihhgfegddeeddddedeedeefbdddeddcdddbedddeeedffedfeefefegefffffgfgffggfgfhhjhiijijkjjjhhjijiijjkkkkklmkmmllnonnlnppooonnonnqnppnnnpoqoonpopppoqprqrrqqprqqqqppqpqprqrrpqpppqproqrqrqqt¾ÿ}|}}{zyz{||~|zvtrpqqqpmnllkjijhhhiffeceebdecddccdcbcccbabaaab`ba`baaa`_`aaaaccdefggghjkkigiiihfffeddeedfedfefehfhgefeefedbeeeffggfegeefeeeffdfeegfffhfegggggghfighijijijlkkjkjkjhjkkklklkkkljllkmnnnnpmnnnononnpoponpoooppononnopoonprqrqrpsoqqpoqsprppqpqpprrpoprpqnsoqqqrs}||}zzz{y~|}yvusqqnpmkmllkkihijgffdgffddedbecbccdabdccbccdab`abb``aa````_bbaedefgefffhhhfhjiifhecdfeffgfggggfhigegeeffgffeeffeffgddgeeffffffffffhffffhhfhffggiikkjjkiliijjjjjjljjjjkkllllkkmmlmlmnnmnonnnppnnnnonnlpnooooppooopqnrppqrpqrppprrqqqprrpnqrrpqoppqqopsqrorqrqqĿ¿¿¿~||}|yyzyz|{{}uspqprqrpnmkklkiihgggeegffeeeecbcccbccbdcccbabcaa`aa`aaaaa``_`babbefeffecefegfighffeddeefdgefhghhhjhihffggeeeegeeefgfgggeffefffffefgeffhgggghgfhhhhiijjjjjikjjkiljjjjjjkikljkkklmklmmnnpnpolonmnoppnonnooponnonootopqnopqsqpqqooppprppqoopqqopqpqoqqoqpoopoorrq¿¾}~}{{yyyxyxy|}}|vtqrqqpppnmmlkkjihhghfgfhfdfeedccdbcccbccbbbbbbbbaaaab`a`a`a_``aacceededcddedefedefeheedcfehfggjjillljjjgggfgfeeeeffggfffgggfffgdegfgggffefhigjjkighhkjjkjjjikikiljjkljhkkljkkklnkjmnnmnnmmmnomonopmnonononoopoooqnnonppqqqqqpqqoqqprpppqqopoppopnopoppoppprqpprÿ¿}{yz{zyzxy|zxvusprrpoookllmllkjggggiffeeddcdbdedbbbcbccccaabbca`aab`aaaaaaa``acbbdeddcadbddeeeheeeeeecddedghjjjnnomljlhihffggfffffffffgfgfeeffggfggffghggghhhgjiihkjikkijkijkjikkmijkkjklkkllknlonmnnnomnnlpoolmonnopoppnqoopopnpnpopqqpopopppqoqpqpqoopqrqooppppnnmopooopnnoÿ½}}{|yz{zyyxx|}|wwtssqooqmommljkjjijghhhigfieffceddcccbdccccaccbbbbb```a`aa``ba```_baacdbbdcaccdddegdgeeddedegdehkmlopooommmkghgfggfffefgfgfgfgegfgfffggfgfggfhfihjhjkjjkklijkkkjjjjjklmklkjllkkkkjkmnnnllnllnlnmlnnnmomnmnnnnnnpnooqqppooooooopppppnpqooqqoppooqoroponnmnnonoopro~|zzy{yyyxxy|}~|{xvvussrpqnmmnljkkhjghhgghheedddededcdcccbbbbadbacbabb``````aa`a`a```ac`abbbbbdbcecddddeegfcdcdefflmnoquvrqonlkighffgfgfgfggfggghefffggffhhffhhhhhjiiiijkiljkkljijjkkjkjljjlkjlklkkklnmlnnnnopoooomnmnnnnqonnooonnloonnoppoopopopopnoqppoqoonooppooonnnomnmnnroooop¼}|{zzyyzywwy||~~|zywxvurttppoqnmllikljjhiiihhfffddeedeccdbcbcdcbbcbababb`a``aa`aaaba`b``a`cbccbdacccccddgfdgdeddbegglnnpsvywrppojkhgihhggggggfgggggffgffggfhigghfhifhjjhkijjijjkjljihjkjlilkljkkjjkkmmllljmllnmomnmnmnlmonnmmpmnnqoooonopopnppopppppqponooooooqonmnonmnnnmnmmlmmnnomp¿}}{zzzyyyyxyxz~}~~|{yyzyxwwvttsrmmpmmllkkjkihfhfghefcccddfefeccdcdcbcbabbaaaba_`aa`c`a``a`_`baabbccccbbbaceddfeeeeffddedgilnrtvwsrqrqnlihhihhffgggggghfhhfgffggfhfhfgfghhkkiiiijlkklljjlkjkikklklklkjjkklkkllmonlnnlmmlnnlnnnmnnnnnopnmomonpoppqppopoqppopopqnqpppnnoononnmonolllmlmonnmpm¿|z{|zzyxyz{yz{z~~|}}}{{yvwxwutrqprrnpomlllkiikjiggggfgddeddefefdcdbbccbbabaaaaaabaaaa`b`aaba`a``abacccbdcccdceeefeedgfdeddfhlmpossrupqoooljjiieghgggfggggfggffgffggghhjgjhikjjjkjjkjhkkkklikkkkkkmlkkkliiilklmlmklnlonnmmomlnmnmonomonlnopnmpmqnpnpmonqppropppqpooooonnnnnnomnkmmllknmmnmmmo¾}z{{}{z{yyyyxxzzz{|}|}{xxwwuuttsqqqqmolmkllijiijihgghfefedegfddeccdccbbbbbbaaa`ab`a```aa`aa`a`aaaaabbbbdaaacdeeeeddeedffcgeggikonnpqqopooqpnmmjgjhfghfihhggghgffgfhfgghhgfgjjlijjjjjkjljjkilkjjjkmllklklkkijlknkllnmlmmlmlknkllmmlmmopmonnonmpplmnnpproqnnqopoqpononomnnmnmnmlmlkjkljmmnnljnm¿~{{z}z|xzyyyyyzyxxzz{{zyvxvuutqrprqoommllkkkjjhjhgifgigffedededddebcbbbccbbaba`cbaba``aa``a`aabbaaaaaabbbbbecddddeeefegffgegehhlknnnnnooornnnmnkhkggghgggghggggfgggfgjgggijjjkkjiiklllilkjkjjkiimjlklkjkhkklhmklmmlnllmlmllllomllknlnmmmnmqnmonoppnnppnoqpnoooomnlnonmpnlnnnlkkjkkljkklkjkmkmÿ¿}}}|}z{yzy{zz{zyy{|zzxxxwwvusrpppqppnlmmmklliiihighfjggfgfffdeeedccccbbbb`aaaaabaaa`````````abbbabaabbbbbbcccdcecdeeeefgfgfggghlkmmnnpppqqqpmnkkhhgigghihgfighfgfgfjffhikjhikijjjlikkkljjkjjiikklklkklkiilkmlmlkmlolmlmlklnlmllkllmllmmmmnnmpnmoonnpmnpnornpnpnnnmooommnnjklkjijikhljlkmklkl¿}{{{}{z{z{z|{zzzwwxwwxuttroqppopnnlmlljlijjiihhighggeffcddecedcccbbbbcab`b`aabaa_^`a`a`bbcbbaaabcbbdcdebbccecfdddeeeffgegghhjkllnnppruvtomljhhggggfgjhkghggfhgghfffghkijijjjjjljhjjilkjjjiikkkkkljlhiillllmmmmlkmljlkklmmlkkkmkomlmmlonokmnoononnmnnopooonnomnnnnmlmmjjjjikhiijkkklkkjjj¿~~~}}~|}{{{{~|~}}zxyyyzwxwuvurtssnnnnmonlkmljjhjiihggjgffgfeefddecdccbbbbbbbba````aaa`a``aa`abbbbdbaabbbbbcdccbdddeeceeeeghfefggikijjmnorstrsnnljhghigijhjkggihhigghgighhhjiilijjijjijljkikjijkihkkmmkkkhkikjklllmllmmlkmkljjljklkmlmlmlmmnmmmmnnnnoponmnnonnmnmnnmmmnmkmjkiihhiihhhjhiiihiik¼||~|~{|{{zzyxwwwvvrrsppnmnnnnmlmkkijjihhgghgggfggdecddcdcbbcbbbbbbaabaa`ab```aaaabbbcbbaabbabbbbbeccbeddcdedfgfffhfdghijjijklnmnpponlmkiihgihhjhjjhghggffffghihijhijhikjkjjjkjjkkikkjjjjjkjjilkkkljjkklmmllmmkllkkjkllkkmnmlllmlmlmnnknnnnnnommnnpommlnnmmlkkkimiihhhhihiihijiiihi¿}~zzyzwwwvuttsrprnommommlkjljjiiihiihgfggffdddcdddcddcbbcaccaa``a`aaa```bbbabbbcbbabbbbbcbcdcddcceeecfeffgefeeggiihihillljlmmmmlijhhiigghhghfggihgggjiihgiihiikjjijikikijjhihjiklkikjlikkjkjmkkjmjlkjjllljlkkhkklklkllllllmmmonnnnnnnonononnmnnmlllljjjihjiiihihhhihgghhihhh~~|{ywxuuwuturroqonmmlnnjjljihjhhhghhgggfeeefdcdccccccbabbbbbaa`aa`aa`baacbcabbcbbbabccccdcbeccddddeefffefgffghghhiihiiikiiiikllkjhjihhgjgghhgggghhhhhkjhhjgijhhijjjiilijihjjjhjiijjijjjkljkkjjkkkklmkkkkkkkkjhjkklllklllmlmlllmnonnmmlnmnnnmlmonkmljkjiiihhhhhgghfeggfggffg~|{{zxuwvtsrpqppnnpolmmjkjkkjhgghehihihedfeeddddcdcdbbbbbbbbcaa`aabaabaabcbccbbbbbbdbdccdbddecddcecddeffihifhgfhghhhhjhhhihhjmllkkigggggigffgggggigiighihijhjihiihjjjiiijgiijhihhihijjiiijiikkkkmkjijlkikkkijkikjjkkklllkmjnmlmmmlnllmnnmlklllmjiljjhiijhiijgghgggfffegffeeÿÿ|{{zyxxwtrssqqnoopommnmlllkjkjihhihghfefdeeedcedcdcccdabbbbbab`aabababbbbbbbcbbccccabbbcdcccbedccdfefefdfhghgghhhihhhhfigghghlmjiihhhfgfeeeefggggghhhiigghijihhhihhhhjihihiiihgiiiiiihjkjkkjiljjmjjjikkkjjiiihjhilljlkkoknlkmmmlnlmmmnlnlmnjkllkkhjijihihhgihhhffefedeeeeeeÿ¿{{{|yywxwuutsqsoqpoommmlllikiijigjhfgfgddgfeededcdcccdacbbbbbbab_`aababbcbacbbbbcbbddbbbacdbddcedeeeffffffgihhghhhhghhfhehegghhjhhgggffgfffedecehfhgggghhgghhggggggigjiiiijiihjhihghggijlkjjijijhjjjighiiiiijihjjkkklihijjlllmmmlmmknlmlkljlkklikiijghhhhhihiggfeeddddfcdcec¿~{z|yx{zvwuuqrqqopnnonmkljmjjhhhgfhffggfgdefeefgdcdcecdcdbbcbcccba`aabdcbcdccbcccbbedccbbadeeeeeeecdeedeeffghhhiigghhghfgfeeghgghhgggeffeefeccbbdeghfggghhiggihhgggihhhhhjhiigjfhighggighijkkkkljiiihjjjiijkhhihhjijjiljjjjklmklklkmlllnkmkljljjjihhhhhghigghghgfeffcgedddedf||{zzwwvuusssrqrqpommlllmjlihihghfhfghefgggeeffedcdcddcccbbcbccdcbaaabcbdbcbbbbcbcbcccbbccceddcdfdfgfgefhhhhhhiijghhghghfhffeedhfgfgeefeeeeecaabegeehdffffggifghhggiihjihihjhhihgghghiiiijijkiihjhjiihijhhhjhhhjiijkjjiijiijlkllmkjklijmljikiihhihhhigggfhhhfhgfgeedfdeeeeee¿~|{{zzyzxxuurqtpqpomonpljljjkighgghgfgggfefeeedeedddddcecdbbbbbbcbcbabccccdcccbbcbcccdccddddcdeeeddefeefghfgihghhihgghghghggfeffeefecdcdecddcccaa`abcfdgeeeffffgfhgeghfghgfhgggiggggghgjiiijikilihihhihhhihghhghhhijijjiijhjjlmljiklmlllliljjiihjgihhhhhfgggfefgfefffefeeeeggf~{}|}zzywvuuttqrqppnnnnlkkjjkjjhhhijhhegefffeedfeeefcedccccdbcccbbbcbbccbcccccbcbcedbdeddbddcddcefgfdefffhhhiihihgiihiggghgedddefeedcddfecdbb`aa`_aadabccddefffdfeefffgfgfgggigfggifhhiijjjkjljjiiihhghhghfhigihhijihihhjjjkimikjkjjkjkjjjijihhhhhhhhhghffhggegfgfegfffeceegeg~~~}|zzxxwtstsrpqppponnnmkkikijhiihhggfgegffeeefeeededdccccddcbccbccdcccdccccdcbbccddcdddeccdeeddefgffdffiggihighhiiihghgffffeeeecddccecbdda````__`_a_`abbeeefdfdfgffefffffhhhgghghghihhihiiiiiikjhihhhhhhgfghghighhghhijhjgjjilijlljjijijihigghhhhhggfhhhfffeeeefffedfeffffff~~~}~|z{yyvurtsrqqqpoonnmkkkjiijigjhgigfgefggffefdeddfdecceeddccccdccdccddcccdddbbbdcfcceddeeeeddfgdfeggdhhhighiihjihiihhfgffeeedccccbcedcbba``a^_`__`_`_aadbadddgeeeffegeegfhehggfggggiijikkjikihihgghgfgfgeggfhghhhhjhhhigijiliijkjjkjijihhhgggggffhfggfgfffdeeeffgfedfeffggf¿¿}||yyxxwvtsrrqqpppmmmnlljjijiiifghigffgffefeefddeddccdcddccacdddddecdccecccdcbdbdedccfeefeeddffgfefeehhhigihihgihghgggfheeedccccddbbbbbbaa__^^____`_`aaababccddfefeegegdfffffggfgghgiiiiiiihihjgfeegggffgffghihhifhhhhhiijikliiiiihhihihhhgefhffggggffeehefefffffdefefeffgg¿||{|zyvutrutqtpopqmnonmkkkljikjihihhghgfgffggeedeeeeeceddddcdbccdddeddcdceddcdebeddfeefddedffffggeggfgifghfhhhghhhiihhhgfeeeecdcbbcdabaa``_`__^_______aaba_caacdeeeeefefffgeffffhgghggfihhighjihfgfggedefdfehhghggggfgigiiihiihiihhhighhhffgegegeggfffeegedefefgfeeeffhfgfgh}{{yyywxvuttrspppnpmnonlmjkkljiiihgfihggffgeeeeeeedddddcdddddddeedddeeecdccdcdddcdeddeffgcfffefeefffhggghehfghhihhhhhifgffgfcdbececdaa```b`_^__`_____`a```a_`abdeddceededeeefeffghhghggfhhghgihiihgfgegfffffhghgggfefffggghkhijhhhhhhgggffgffeeffefgffgecfdfefgffffgghhhffgh¿¿~~}}z{yxwxuutqprpooopommkllmjjkkjkijjhgggffgehgffeefefdeceddddceceeeeeedfecddddefecdegdffeefeggeeffffggigiihggffghghiihehfegffeecbdcbc``_`_``__^]_]____```ba`__`_cbccdffdbdedfceffffggfghgghhghfghhhgeffefeefffgeegfgeffffggihgiiihighgffgfeefeeffgcfegdffddeefeeeeefffegfffgi~~|{|ywxttvtrrqppoommmmlnnmjljkijhhhhhggihgifffgdeddeeeddddddhegdeededdeeddhededddccddecceefehffefgegghhigggghihihhhgihhgheddddbccadbaaa````___^___```_aaaa`^__``ceeefeedccfdbbecffegfffghggfhhhggggffffffffffeeghgeedeedgfefghhihhgggfefcfeefeeeefefeffeedeffgededefffigiffg~~{}{|zxxwwtsrqqqononnolmnmlljiiiilihhhhiiggfgggggeedegdedceeddeeefeededdfcecdfceefdcgceefgfgfgffgegfggiigjjgghfggihhihifhgedeeccaacaaaba_``___^__^_```_`a`a_`a___cdbdefcadcddddcbecefeeehffffgfggiggggffdffegfeeffefefeedeffgifhfhghfefffededefefeffffgeeddfeffefdeeefghggfgg¿}|}}zzzywwvvrrpqqqoononklllmmkjkkjkkjhihhhkgfgggfefedefeeedfdgefefedeeeeddddfdfdddeeeeedfefeffffffegfhghgjfgggiehhghgiihiihfeedcdab`adcbc`____^_____^_`_````____```ceeedccedcbacedcdeaeeegfffffgfgfffeffdfedefdeeeedcdedceegfgggfeffggfdefdfedfdegffheffefefeefefffaeffffhiggg|}}}|zyywvsttprqpoqpnmqoonmmnkjjkhihihhhhhhjhhgggfgffefeggeedffgffeefeeddeegdedeeeeddeffgfeffggfgefffgghgegggighghheiffhieefgdddcb`baac`ab`a``_^____a`_``a_`____``_`cbcbecdbdadcddecdaefffffefefggfffhfgeeeefeedeedcccccdccdefchdfegfdbeebedeefefgeefggeeeeedeeffdebeffhgggfhg¿}|{{zz{zwvvvttspqpppppoopoommkkmllkljiikijkikjffggggfeefgfgeeegfgfffeedegedcedefdfegeedffegeeehfghifgghgihghghffgfhghhgghfhffdebacdbaabaaaa`^a_^__^_a```_`__``__`_^``aabacbcbabbbccabbcdcfeeeeffgfegffefefeeedeeddeddcdccdedcddecgffcfdgeeecegdffefgeggfgffeffefeededfeefgfgfig¾}~||zywxywwustqqqpqponpnonoknmlknjjlmllkiiiiggijggighffefeggggffeegfgdeedfhffcfedeeffffceefffggfgghhjffghfgifgffhgfhfhggghdedbccc``dacabbab_`____^`_a__``_`_a_```^`_```dbebccabbbafbacebcdeeffeefegffgcffdeedeecdddbccadcaddbadeddbcbddacadddeeefhefeffeffegggeedfedeffgfefehh~|||zzzzxxuttrqpqqqqppoononommmllkklmlliilljljijihghghifggfhgggfeegfffegefeeedfdeeeieffgeedeffffhgfighhhghhhhghgggffhghhfgeddccdcaabbbbbab`a_a__`_________``a`aa_`__``c`bcd_```bbbbbddeedfdeeeedffgfdfedeeeeeccbecccbccaaaacbdcdecaadc`dbaaedeeffeefeefgfffeggegeefeedfffgdhfh¿}||zwzxwxtuuusrqqpqpqqpopnnnmnlnmmllmkkllkljjiihjigghfeghhiggheffffgeghfggfefgefeeeffdgffeffeehhgjhjgghifghiigifhgggegffffecedcaac`aabbbcc``__`^`_`````_`^```^`^__`a_`adc`aa`__``bacfeedccdbcdeeefdeefbecddcdbcdcbccbcbbbbb`bba`ab`abc``a``ccfeeefddeffffffefeeffddfeegfffehh~~{{zzzxwvywvttrrqqqqqpsoqnononmmnmlmlllmllklljjkkigiegihigghghffhgfghffgfdegfegdfgfeeefeffgefhfgjhigjhggfhgijgfhifgfgfgggeefecebcacbdb`bba`a__^``_^_`^``___a``_`_`a`__``aa`b_`__`aaabdccdcecceaeddeccbdccedbbdcccdcbb`bdcbcdcabaca_`a``aaa`bbcdededddedfeffdeefdeeffedfedeeghg~}~zywwxxxuuussrsssrqtrpooopqpnnnpnmollmljkmlljkkjiijighfihgggghgggghfiefefffhfhfgffhfffhdhefgghhhhihffghihhhhhggffhggfgfffcdbcbabac`abbaa``a``a________`^^a```_````_^aca`_`___a`baccdbdddbcbdccecccbdedcddcdaccaabcbcccbabccaaaa`b`cb`aaaadaddddefeeeddfdcffeffeffefdeghfghh}{||{yxxxxwvwuttututrrsrpropqqpqnnonmmlommmllkjkiiijihhjggghgihiihfgihhggfeffeghfhgfggggggiigjgfhiiihhhhgffigggihffgffgfhffcdca`acaaaa````a`a`_`a_^^^___]_```_`___a__`_a```___`a`aacbcaccddbcbbabccbecaacfcbbcabbaa`babacdccbbb````__`aa`aaccddcdddedeeecddefefdehfdeeggfeefhÿ}~~|{{zxxywwvtrttttuttrrrpqpqqpopnpopnmpnmllmjlkkkjgkhjhghhhihhhgghfhgiifhfffhffggggehhghgighgigjhihiiihhfiigiggheffgfeeefdfbdbabbb`a_``a`aaca```]______^____```__``^``aaa``_``b`b`bebaaabaaa`bbbcdfbccbbbcdcdbacaccbdecdecdca`b````_``abaaaa`babdbccbbcbbecefffeedbeeefgffgg~}}|{{zxxwyyuwuusuvtttrsrsqsrqpqppqopmnonmnlkllkllkjihihhhigigiihigifhggighgfghhgiggffghighhfjhjgiikijhfhijhghfggggehefddebebbcdba`aa```aaabaaa_`_^^_]^^``__`a^_^`__^_a```_``aabadabbbbaaabaabbbaecbdededdfdddccbceebceeddcdcb`_```````a`ababbcbebcaccdddbdbddegdeedcfgghhei~}}|{{y{xwyyvwvwvututtsusvsrrqrpoppqoonnommllllllljiijhkhjjjiihkhhghgihhgggihfffggggfhjigjhjfiijkjhjkhihghighgihhffdeecedecebccaa`````a``aa````^_^^__^_____a`a```_`_```__`````acccbaabbaaaabaaedddccdddfeececceccceddeehceecdb````a``aa`aaaa`cbcadcac`adbdbdffeedfcfffggigĿ¿~~|}zyyzx{xyvwywxxtwwwwwvtvssrqsrspqooooonllkllmlkkkjjjijiijiihjiiighihiighhghiihggihhihjijhjjhiiijhhggihgigghiggghffdfdfdcddbbbcb`a`aaaaba``^^]^`_^`__`^]__`__a`a_```_```ba`abab`ababaaaabbedfdbdccddddffeecedeedfffefeeecca`aa`````aaaa`aaccccbdcfccbdefdegeddeeffhgffg~}||{zzzyzwzwwwwxxxxwvywvususttrrsqrsqponnpmlmmmmjjjijkjhjiiiiiihighigiihhhijjihghjhjjiiijhgjighjiiihigfhjggihghhhffgfedddcbcdeba`baababba`a___]_^^___\a]```___aaa__b`a````_abaddbaccbcbbbaccccbbdddededddebbccdedeefegeedcc`a```a``bbaaa``aacbbcaccdadeedceefddgffhgggg~}}|z}z{{z|zyzyzyzzyyyxvuusuttstrurtrponnnmmmlmklkkkkklhhkkijkiiiiijjkiihhhhghhhiihiikkjijhhjhjjjhkhhhjijhjffghfgddfeedcedcfedcabbbacabbb`^`^__^_^^__^^`_`__a`a````_``_`aabbacbabbbbbcbbbccbedddddfdbdccddcccacfeefebcb`bcb```_``aaab`abbabbcbcdbeebeeccebeececfefgdfe¿~}}}}~{{{{zz|{z|zyxyytuwvtuwvtxwvrroqoooommmmkkklikjkjjjjjjjjiiikhijihhhghiiilklikkhjijijijkjkkiiiiihihigiiiigggidehgdfggefdfccaaab`aaab`___`^_`_^`^_a`___`__`_``a`_`^`aa_abcbbcbbaabccbeccbddcdcccbcdecbcaefeeegceb`bbbbb```aa``a```aabbcbbbcdccceeedcccfdedffegggf¿¾~}}~}~|{{{|zzzwyxxxuuvvxxyxxuurooponpnommklmllljkjjjjjlkkjiiijijiiijijjjkjikkjkkihkikijhkjihjihijghiihhjhfhjhhhigeihfheddbaaacbaaa`aa__```_^_^`^a^`___`_`b```_^_^_`_`aaccdbbbaaabbbccaaccbecbdabebbaaadccbbeddaaabbbbaa```a``aaaaaa`ba`bcaddbcbdbeddbefcedfefdg~~~}}|z|{|y|y{yywvywxzzzxursrqpoopnpomnlmlllmljljjkkjljiikiikkhigiiijmkjljkjjjjkkkjijjiiiiijjiihjkghjjihhjhghgffhggfcdebaaba`ba``aa___^`_]``]`_^_^_a_``aa__^__`__a`bbbabaabaababbbbbaabccbbcbcbcbb`cbbaccdca`abbbbbcc```aabdaaba``aabdbbbccccbccbcdcdcedeefee~}}{{|{{xxwxyyyyzzwvutssprqrrqnmnmlnllkmmmlkkkjlkljjjikjkjijjjjikmlmliilikjkjijjjkjkkjkjiihjigjjiiigihhhgghhhffcebbabaa_aaa`a`_^`^_`_^_`__``_`_`_```_`__a^a``abaaaabbaaaaababaabbabcbabbabcbabcaa`acbcbaabbbbbcaaaba`a`abbab`a``baacbcccbbdcabbdddgeeff¿¿~}~}~{|z{zzz{zzz{xyuvutrrqrqponnnnmmlllmmnklljjllkjkljjkkjkjjklkmkkllkjlkjklljljkjlkkjliiiihjjijhhhjhiiggigihfdbcaccbb`b``baa`^`````_`_^_`_```aaa_``__ab_a_aa^a`aaa``aa`aaaaaaaa`abab``babaaacbabbabdddbbcbcbcba`b``ba`aaacabaaca`aaaaddbbcbdcddeedefd¿}z|{}{y}zz|{|yzxxuusrrpponnnommmolmnonmmlknmmljkjkjjjklllkmllklmkkkikmlllljkkkjkjkhhihghhjjjikhjkghihghgeacdb`a``a``_aa__`_b`aaa```___`_`````aa_```a_`_``aaa`baaa`aaaacabaaa`aaaaabaaaa``baccabbcdbbbbbbcbaaaba``aa`a`a`acaaaacaabaabcecdeccfdfef}|||}|}}|}xzxuutrpqrpoopnnonmnmoolnkllmlnlmlllkmjlmnmmllkkmlllklklmkikkjkjjjkjjjjijjkiiikkjijjghgfhggddbb`a`a`b`a``bbb`ba```a`_`____``_a___```aaaaa`a`aaa`aa`aa`aabaaa`baaabaabaaaa`baaa`ccaabaabbbacddba`cbcab`baab`aaaadacbdebebddedfdbaeeg¿~~}{|~}|}zxxvwvsqpqppppommpnoomqnooojlnlmnllkmnmolnmkmmmmllmllklkjklkkkkkjkkljhkjjiljjjjiiiihhhheggeeecabc_`cb`aaaab`a```^__```a_``_`_a_`a`a_a``aa`a``ba`abaaaaaaa`bbaa`aaaaa`bdaca_``b``a`ba``aababacbcbaaa`cb`aa`ba`acbbcbbaccdadfceecdggf}}~}}zz{xwvuustsrprqoopnmoppnopnpnnmlmmmlllmmkmnmmnlmmlllnlllkkkklkmlklkjkkllljkihjhhjijiihhhhhegheedccbda``a`aa``_aaa_`a__`^a_a``_`__``abba`aba``a`baabab`aaabbbaaabbbabaababbacbabcbba``ab`baa`baabba`a`aa``aababaabbaabcceccddefeeeffege}~{xxwxttvvtssqrrqqqqoqppoppmnppnomnmlknkmomnnmnnmmlmmlmmmnlkkklklmjkkjjkmjijjihjkiijgikjiiihhhgfddcc`a`````__`a``ab```^_``____`_`_`babb`baaaaaaaaa`aaa`a``aa`acabaaaaaababaaababa`aaaa``a`baa`ab`baaaa`aaabacabbbaabdbcbbaefeceeeecegedg¿~{ywwwtstsstrtqqrrqqqqqpqrpqmopomonmmmomonnnmonnnommnmmmmomklmmkkllljkjjiijhkjgijjjjkijkkihjiihheedcccb`c`a`b``a``cb_b````__`_```bbaaba_`bb``aaa`a_`a``a`baabbbaaaaaaabbbaacbbabbaacb`aaba`acaaac`aa`bacab`aabdbacaacccbdddddfffedebfeeff|zvvuuusrrtssttrrsssstspppppqonooopnnmnoooonnnonnonmmmlnnmmmlmkljlkklijjkjjhjijlljikkjjljjiiihhggeddcdc`ba``ba`aa`__b____```__a_``abb`babbbaaa`aaaaaaaabcabaaabb`aaaaaacbbbbaadacd`babaaa`aaba`aaabbbaaac`b`aaabbbbebcddedeedfedegeceegee¿{zzyvuvuutsuttttrrrrttsqqqrprpqoopoppopopoooopnnnoonmnnlnmnllkkkljljllmjkjijikikjhiijjiijhhhigigffhfeecaaab````a`_caba`_`_````b_aa_a``aabaaa_aaabaab`aaaa`a`daaabbbaababaabaaaaccbbcbbabbb`aabaccbaaabb`bbabccba`baccdcbfffbededfedgefegf{zxxuvvwuwvwvuuuuwutsusustrrsrpqpppoonpoppoonmnmmomnmnmmmmnlklkjllkkkjjkjgiigjkjiiijjjiiijhifigffiffebaaabaaa``a`a`aa`aa``a```_a_`aa`caabbaaa`aaaabaaaabaaaaabbabb`bdabbcbccbdbbccabaabbbaaaaabacabbdaaacaaacbaeccceccfdeccdeefeeefegegg¾}|{vvzwwwxxxzxyvvuuvttsstrsrtqoqrpqrqoppooppoonmonpmnoomknnnmkllkjjkiihjhgjgiikkgjiiikkjhkhifhfhfgdcecaabaabbbaa`cb`b```_``____aab`bbabbbbac`aa`a`baaaaaacbbabaabbb`abaccdeddbbdbbba`ab`aaaaaaabcbbabbbbccbbcbcdaddccggfdeedfeeffggggeeg{|{|{yzxzyz|yxxwtwuwwutrsttsqsrppprqpoorppopponnnpnnnolmllmljkkkijihgggghigkkkffjkggjjiihhghggedcecebbcbccbcb`a`aaaa`^`_`___a_`baab_cbab`baaaaaabbaabaaacbbababbbdababbbaaccgcbcda`c`aacaaa`aadbac`bbcdbcbbadeefdefedgdefefffefffghghh}||~}~{{}{|{{yxwxxutuvuttsruuqpspqsqpoqqpoooopopnnonmmmmlmljkllihijiiiggiiihikiijhiijiiifhffggdeeddcccbbbcbacaaaa```a`_a_```bb__``accddabbbaa`aabcaaaacabacbbabacbba`cafabebdcdcbcbbaaa`abbbdaabceccccdcbebdcbfcecdgdfhgggfffghffggegf|~{{}~}|{zyzyyuwvwvsuvtttrsrsqsqooqrpoqonponnoommmmlmmmiiliikjhkhgggijiijjijiiiigigjghghegfeeecbdbaabaaaa`baab`aaaa^````__b``bcabcbbcaaaaabbacabacaabccbbbbacebcabbcddbcecgcbbcaad`ca`cddcbbccaadbddecdcdcffedfefffgfgeffggdghhfh~||}||{{zyyyyxuvwutstsusqqsprqpqoqqqqqoonnonopnnmmklmlmnljkkihhhgegffeiiikjiiijhjihgffgeeedefeedbaab`aa`b`baa`aa`__aa`baabbbbababbbbbcaaaaaababbacbbcabcbaebcacdadbceffebbdedcccbaabbdab`accecdcccdeddcgadeffdeffgffhfegghggfghg~}}}{{zzzzxxvuuvvuvvususrrtpsqrporppppponnnomollnonljkkkhjihfgfhejefhhhkmjijigghggeffcddbcddcccbbaabb`bba`aab`a`a``a`aabbba`bbbcbbabbaaabacbcacaaafcababbaeebdeaeccdcceddcccbbc`aabdeceaccceddbddcecefeceegefffgggfffhghgfhhgg}{{zzzwxwwuvxuvstvurtsssrsqqrppppppopnpnpnlmlmnmmlljihhhhggfeggjjhjjkhijhffhfefeedeecdebcdceccabaabaa`baa`aa`baaabbba`abbbbbbbbccba`abaacbabccabcaaacbdbecbcdcdcdedeeddcccccddcababdcdaccbddecfedfegfhefghegfffhfhhgfihhgh~{z{yyxxwvyzwwwusuuustsqsrsuprqqpqooononnmmmmmmmmllijhfggeeffhfjihgikhgegfeeedfdefccefbdeccbba`a``_aaabcbcacb`a``bbbbab`bbbcbbbbbdabbbacecbcbbccadbcabcdeddbddccecbeebbbbdddaabcbbcbedecededdedeffgfeffgegffhfhefehfghgff||zzyxxxxyxxywxuwvvrrsvrurssqprrpoonomonnmmmmmnmmlkkjfggdddeefgghjfhjhfefgefeeccdedddbabbbb``aaacabcbbb`bacbbaababbbcabbbbbcbbcbadcbbabbbaabcaa`cbbccacdcdcdddcbdcbcbbdccddbdccbbebcbdccdcdedfeeegfgedfdhfffhggfggghfgii}}yyzyyz|zz{xxxxuvvuvutuqttqsqrqnoonnnnnnnmnnmnollkjghhfcceeeggghehghfgdfgecdddcccccbabccbcbabacaacaab`abababadabbcabcbcbbbbcbbccbabdbccbaacccbaaacaaccddedcbccdedecdddbedecedcedceeceddcdceeeegdfhfgfggeghgiggffggfhigh~~{|z{|{{{z{zxxvvtvuvttsttrurqqppponnoonnmnnmmommljkihfddeddgheeeefghfefdeeecddcbdcdbcdcccbacbba`bbabaacbacbcbdcdabbdbbbbbbbbdbcabbdacdbabbcdcbdbcbddddfededcccdcddddebcbdcbddbcececdcdddeegdfdgffgghhgfhgfhhghhhhhgghh~~|||{}{z{zyxywvzvuttvttrtrrrpqoopnmonnnnmmmmllkkjgihjgfhgggeeffeeideedcddddedbddcbccaccbcbbaaaaaabbccbdbbbabbbbbcbcbbbabbcdddbcbaddcbcabbbbfcbacbbeccebcecdbfdfbefccccdebcdgbdcdbecffeedffghfhggghfgghghhggghghghhgh}}~~}}{{z|vxwvwuttuvrqsqpqsqnnnnmlnmmmnlkljjjjfehfggggfefeddeddeeecfdeedddccbcbbbbbcbaabacadccccccbbbbbbaccbcbbbbbbbddccdbabccdccbbbcebfcbbddeecfeedcdcfdecdceddcbdeeecefeeefcceheffdfeeggghgggggghhfhhhgefgghg~}{|{zxvxwwvstuttssqpoopnnmnmnnomonnjmljjihgeeeegeeeeedefedeedeeecddcdcbbcbbbbbcbacabcbbcaccccbcbbebccbdbccbbdedccecdebecccaabbbbefceddededbdeeecedefdeeccdeecccbecdeeecedgcgfedgfhfggfhihhhgghghghhghhhhhj}zzywwwsuuvtsrqqropopnmnnnonnnnnlmkiihgfffghgfefffeffcdedededddcbcccccbbccdcdcbbb`cccccbcddcddbbbbbbcdbcbcbdccdddbdcccbcddbabcdfdddeedecfeccebdfdcdecedebabbcddedeeegaeegffffffgfhhhgfghgghhhghhghhhhhh}}{yxyywvvttuutsqqoqpooomlmoommnmmkijghhggggigfegffeefdefcddccccedddcdcccdcbdbbaabbccdcbdecddceccbbbcdcddbccbededcceebdbcaabcdceedeeefecdcddedgddedcfcceddceeebddcdcbdcfebggffegghgghghihhhhgghhhhgghhgi}{zxxxyxwuussrrqqppqoonmllmnnnmlllijhihhhgjgggeddedeeddfcdddddedcecaddbcdbbcbccbccdddedcdccbccccdcdbcabbcdfdcdeeedddeadbbcdbdbdeffddgfdefedcfcfgbddddddedebcbdfdffffgedggggehfgfgghghhfihghhghhhhiighii}{zyxxwwxuusuuupqopnolnnnnnlnonlmlkijhgeghghhfffdfdddededededdecddcbdbccccbdacdccdceccceccccccdcccbbcbccceddfdcdddedceeccebdbedeffeeggededfedeeefedefebfeeeededeffeedfcefffgefgggghhhhgiihiihghhkhhhiik}zzyywxxwwtssssqtqopononmlmoomojlkigfhffeffhfegfeeefedefcdeddddcddcbbccdcccdcccdcccccccdccecddcdcbccbdbceccecfbdfddcedecdbcdfeeecegfefefdedefedddeddgededeecfeeddffdeffegggggfggghhghihijihiihihhjkihii||zyyxxwwvuvvstssqpoooonmlmmommkjjhhhiffgfggedgheeedefeeeedddcdcceddccdddccdbcdccccecdcdcdececccdbeefddeccdddfecfegefcedacdefeffeefeefffddffdeeefededecfddefeeeefeegfdehfgffgghhggghhhiihijighhiiijiihi~}{{yzwwxxvvtsssrqopoononmmmlmllkkjiihhggefgffgeedddededecddcdcdddcddcdabccbccdbdcecccdccccccccedcdbdcbdddecdddfcdcdcebcdddefefdeddgcfeffdefeeeffdfgfffgddffdefefggeffeggghhdihhhigihhgihiiikhhihjghihi~|}|zxzwuwywutustqonnmnnolpoonkjjjihifgfffeegedddeddddefeeedddcedcddbcbcbbbceddddcccdccdcbccccdcefdbdddcdcdeeccdfggeegegfeffffdffefefeffeefffeeffeceeefefeffffeegfggfgffggfhhhiihjhhhhhihhjiihhihjijji~|||{zyxwyxywvvsttsrnopnonnonkknnjjkhfgffeeegffffedeeededeeddddddcdccddcccccfddcfccdecedeccdccdedbdgedbddedfdhdfgdgeeffffffeecefeeeffeegeeegfgeffffgefgffgfegeeghfffhhgfhghhhihhhihhijjiiijjikjjiijjjj}}{|{zyxwxxxvuwturpqqpnnnnmnmlkkjjiihihgfffgefefedefefeeeedcdcdccdcddccccddddefgfdccdccbdedceedcceccbfddcfdccghcgfffdfffeefefddgdeeffefhgegegffgfefeffefhhiegedgfgghghgfghhhhhhiihhhhgihjijhjihiiihii~}|{z|y|xyywxxvuuqrqsoqnonmmmmknjjjiifghehffffgdddeegdeedccdddddddcdddbdcdeddddeddddcfdeceeecdcddfdededfdddffefhefggfgffffdefffdfffbefegfffeeffefeefffeghgdghhggffhggghfihghhihgijiiiihihhikiiijjkijk{{|zxzyyzxyxuspqqropponmmlklkjijhiiefgefefeffdeefeeeddecddcdccddddccddeddfdeeddcccfcfcdeeeffdffefcdddfghgfggggggfgfeeffeeggfgffgffegfegfgfffefgfffififghhfghhhjhhgfhggfihghhhihhijiihiijjjiijhjjj~|~zyzyzzywuvtsrqqpqoonnmnmkkiihghjgfffgdgggfeeeeeedeeeeecdbcdddddcdeddddfdeedcddcdcdefffeffeecdbcddgfdehfdeghggffffegffdcegffeedfffeefggfefgggffheheghhhhhhhhhgghgghhjhhhhiiihhiiiihiijijiljnjk|~~}|z{zywvwutqqrqpoponnnnlklihjihgfgfggfffeefcededddfedddcdddedeeeeedefgdfeffeeeeeefdfefdefegeffefdffffegggfggfggefcfedffffgdfgcfefffegfgfghhfhgiiiiiighghhhhhghgghhiiihihihiihiijkjkjjikkjjjkl{||zzyyvuuusrqpqqopoonnnmjmiiiijhffgfffeffdddfeededgdcdcddefdffgfdeddddeedfddgfdfedfcffeeffeefceedhfgeffegeggfgggfffegdgbbfgdgffdgfffeggfggfhjihhighjhhhhhhghghighhjhiiijiijijiiikjjijlilklkk~|zzzzywutsqprpqppooomnllnkijihihhiffghgfgfgeefeeeddeedddedfgefeddgfeeeeefgfedeecfgffghggfdggeffgggfffgfgfghgghghgfegfggdfeefffffgegggfghhfhggfihihiiijhhhhihjiigjihiihhihgjjkijjiikkjmikmjkk||{zyyxwusturqpqpoooomnnmmljkjhghiggheggfgffeedeeeedgdfdddfgfffeeedeeedgeeedghfefeeddfeegfgfejefggegghfghiggfghfgffgffffeeffffgfgfhhfhfgghhggiiiiihiijiiijhijiiiikhjjhkjjijhljijjjiikjijlknkk~{{zyxwwussrtsqppopoonnlmnkhikihhhhhfhgfeffefeedeegdedegdefffgfheedeegffcfffeffefedfeeffggegfhiggghghhghhghghgggigigfgeehgfggffgfghfiggfghihhhhijjjijiikhhiiiijhijjjjiiiiiljjjikjjkklkmljklll{zyxvtsrsrrsqopqnooonmllllkhiihhghhfgffffffeffehfeedgedfeffeegfefeffeeedfeehggefgfeggfggfghghhhgghgghiiihhfggiihgffffefgfgeggggggiiggfggihikijiiijijjkiiijihjjijjjjjjjijijjjjiikiklklkkkkkk|{wwvuusrtssqppqqpnomllllkkkhjhggegggegffdeddeeeeeedeeeefeffggfgedeefdfeefffefeegffffghgghghiehghhihghhgghihhigghhgggfhfggfgfghghhiiggijjhjjiiliijkjijjiiiiihiijijjiijkjijjkjkijmkkkkkkkkkk{zwwvttsttssqopqonolnkkkilhjighfhgffefeeedffefdefefehgffgeffiefgeeeeheedfgdffgdfffggefhhihhhgiihihhihhhiihiiihiiigggggghghggghfiiigiigkghijijihjjjjjijjjjhijjijjjiikhkjjhljiijkjjllkmklkll~{{yyvwststutsqoppoommkmlkkljighgeeggfggeffffeddghefggjgfeffeefgfeefefegfdghegfhfhghhggeghgiikgjhjihihhjhhijhjgiiihgggfgigihihgihhigiijigijjkjjjjjkjjkjjijijjjjjjjjjjmkjkjkkjjlkolkmlkklllk}|zwwtuutststurqpqponnlklklhgjhihhfjhgfggffgiffefffghjgfghhheggfeffdeefegdiggefffghhhgihhijhiiiijhjihiihiihiijihhighgghighhgihhihijjkjjkjjllmjllkklkllljkjjkjjkkkkkkklljkmjmkkmkllkklllknk}zxuvvvstrqrrppopplommmlkjlhfiihgggeggfefgejgfghggjhfighffefeedefgfgfeegffeeegjhihiggikijjiiijihiijiiijijjigjhhhigghgihhhhhhihkjkjkjjjjkklkllllkljlkkkkkkljkkkmkkkkkkllljkmmomkmmlmmllln~~~~~zzxvvvwtsssrrppqpnpookmkjjiighhghgfefgfegggghfghhgiihhgggeffhggggfffedefeghgfhihhhhjkjijjijjjkjhhiiijjijjjjiijhiihhghghhijjjjjikkjilkllllmlklklmmlllllkkkkkklklkklklmkllokmnnmmmnlmnnlml~|}}}~||~}|yyxxwutsrtpqqrppopnlmkijjigghghghgfffghigkfffghighgggigffhhghfffeefecdgghihhhffhiigiijjjjkjijhhkikijjijikjijjijighhhjhkhhiiiljlkkjkmllmlmkmlllllmllmlmklkkkkkjlkkkkmmkllmmlnlknollnnnq~~~|}|}}{{{||~~~}}zyxxuutsqsrqqqponplmliiihigfhgghgggggijjfgheghhiifhjgijehhhffefeeeegffhegefhhggijhiikjjkkkjjkjijjjijijiijikkjiihhhgjhkilkkjkjjijlklllmlllmlmllmlmkmnmlklmkklklmlmmoklllooopmmmmlnnmnnn}}~}}{}}|||y|{||~~|~~}~~}~~~{{yzyxwrsqrqmopppnokmkjjiikghhhghhhggfeigihigghhgijilghhfhefggeggfhefeggefgeghijiegikijjlkikijkjjjijijjjjijlikjlkihijjkijkljjljkllklkmmmlnlllmmmmlmmlmmlkmmlolklkkomlommomoomnmommnlmno}}}}~~}~}|}{z}||~yyzyzz~}}|||||~|}|yyz{zzyzz~~}zz{zxywwsqsnppoomponmkjkjjhhghgfhfefefeghfghjijiijhihghhffeffhjjeghegffggghhhhijihiiijkjkjjkiikijiikkjjkjkjjllkjkklikiklkkjklllkllmlmmmlknmlmmmlmmllnnmmmlkkllmlmkmlonmnppnnpnmnnnponno}}}|~}{|}{{{{}||{zwz{z~}~z|{yyz{}~z~z{zywxwwvvwxzz||}}}~{z{yyxxxtssrqnmonoomnklkjijihhggghffgfffgeijghikijghiiihfhfhffgfgegefefgfhghhhghigjghjklkjjkjmkmljjkljjjlklklkjmkllkkoljkljlkjkmlmllmnlmnnolmpnommnmnnnnlkonmomnmkommlpnnoopoommmmooooqo}~}~}}~}|{|~{|z{{}|}{zyyyx||~}||{{yyyy{{{zyzywwwvvvvvwvvxwyz{|~~|zzxxvvtsqsqropoonommkiiiihgjhghhgfhhhfgefkgiigghijjkgjjfifggfhiiehggfffhhggiikkjikkjkkkkkjjjlkkkkjjkkklllllmmkmmlkkkljmkmlllmnmlnmmnmnmnnommnnmmmloopmonollmmpnrnoononpmnpppnnmomnppoq~~~}}}~}~|||{{{{{z{{}|{zzyxyxx{|~z|zyxxzzyzyxxxyuwwwuvuvvvvvuwvz}~~{{{yyywuvsrrppopkmlkkkkiijiiihhhhhhhhhgfghhhhghihkihljjlhikighfffigefhfggihjgjikjjjiikjjkkklkjklllkkmklllmmlolmmllmnmmlnllllllmonmnnmompnnmmoopnomnpommmlloopommmmmmpnnnloomoommommkmonp~~~}}}}}||~}|{|{{{{{||}}{{yyxxzyz{~}|{zzyxyxyyywwxuxvwvwvuuvttutvvuwzxz{x{}}z{yzwurrsqqpopjknjkikkhjjjjiihfiggghfgggfghiiilljkiikhjiifhhgiigghefehghhjilikiljhjjkkkkllklkmmmmlmlkkkllmkmnlmkmnnnmkmmnlnnoloonmmnmqonmnmmmoopnnnpppnppoonponoppnpnppqnonpollpnoqnpnp~~~~}~}||}||||{{{{{z{}|||}zxyyyzxy{}~|z|z{yxywxvxwvwvvuvvtuwvturrsptsutsuttwz~|y{yxxttsrqponnmkkmljjjihihihjhfhggghggggghhgijkjkhkjjhgjiikiihigfgfghfffhhjkiijjjkjjljjklmlllllmlkkllmlnmknmmmlnlmnmnnommnmomlonolpnoononmppqnnopoppnoqmmqponoronpnnnopnooonpmnonnnpqpq}~~}~~}}}||}}|{{zz{|{}{|{{|yzyyx{z}}|}zz{zwxxxuvwuuwusvvvuwttsstqqrptrstqtty~|zzzxtusurorononmklmjjihijhgiifhfghfgghhhhhhihjiikgjhhkjijjjjhjffhigihghijjiklkiklkjlkkkkkllmllmmlllnlkllllllmlnmmponmnnnmmonqnmmnoopnqppnooprpnoppsqtpprqqpsrrnqopppnnropqqoqmnlnmoonpo~~}~~~~~}~|}}||{z{{{|}}{{zzzzyyzz{y~~|{zzyyxxyuuvvvvusssuuvrurrqrppporsqqqrvz}}|}{zzxxuusqoqpoomnnkihjjhihhghhghigfehfgggghggikfkigkjhjiihkhhgiihihhhiihhhhjijjkkkkjkjlkkkllkmnmmlllllnmmllmmlonnonoppnqpnppoqnpprpppqpoppqqqpppqrqqrrtssrpqqqrqsprsrrqporonppmnmnlooppr~}~}~~~}}}|}}|{{{{||}{{|{zzzzzzyyz{}}}~|~}~~zz{zyxxyxwtvuutsssutuvtqqqrooqpqqmpoqruw~~}||{xxxwttqqqomnollljjkjkjjiiijihfiihggghhhghggiihimgljiiijjjgjiikiljkijggjjlkmkklllmnllmmmlllnnmmnnnnnnnnnmppoppppoqqqppqpqppoqproqrrprroprrpqrrsqsrtsttrrsqrqqroqrqrroqprqrqprpompnmnnon~~~~~~~}}|}}||||}{}{}|{{zzzzy{z{{}}{||z}~~~}}{|zyyxyxwvvtuturrstussurqqqqopqmqooqppsrx}|{{|zywuutqrqppllnjklljlkjjljiijiifhfgfhgggefjhijiiklkkjihikhjgkgjlhkjgijhijjkljikklklmmmlmllkmlnmnnnnnnononnooonpqooooppppqroqqorrpqsqqrrqrqprrruusrttstqsttqqsorqpqqqrsqrqqqqornnnnonnono~~}~~}}}}|||||||{|{|}|{zzzz{y{{{}}|~||{{|~}}}|z{zzyxvvtuttttsrsrvsrqnooqpnpqqopnopqpt{|{|||zyywttstrsqnpllmnlllmjikjikjhiifhhihfhhihjhjihgihgikjhkijgijjjmjjiiikijkikkklkjjnlnnllkmllmlmnonmnmoqononqmnnopppppqqqpqrqrsrrprqrqrtrqrsssrsqosttstuursurtttsqssrtpssqopnqpqprsoomoonmooo}}~}}}||||}|||}|{{{{{zyzzz||}~||{{{z~|~~}{{{xyxtwustustsrsssrqqqrrqqpopoqrnnnprruxzxzzwxvutrrqqqoponknmkklkjjjhijhfhhgghigghhhiihihghhhjjiiiiijgijkjhkijikkkljjkjkikkllmllllmmmlmnnllmnnooonommoornpqprpprqrosqrrptrsptrrrrutssrsrrtstsqsvrrttuttuutssssrrsrsrqsqorpqonlmnnomnpm~~~~~~}~~}}}}|{||}|}}}||z{{{{{{{}}}~~|}}{|~}}{|z{yywwxtttssrqrsqqrppoqpnpqooprponpprtuxwy{uututqsoprqqnpnllkkkkjijijjjhjjiijihhifhfhhhhggjhjjjlkiijhjhjgilljkjkkjimkjmkmkmlllllpmmmmnonmmmnnnnqpqnnonpoorqprpsqqrqqrtsussrrrsrsssrsttqsurttrtwttvuuttvvttsutrrssssstprrqprmonnmnonmp~}~~~~}}}}}{{||}|~~}||{{}|{|{{{{}~~~~~}}}~~|{zzzyxvxtssrsrqprrorqoroppoppsoqqroqpssvvuvvvvtssrqpqpomnoolmjkkjkjkikkihjjihighjigehiiiiijjjjkhijjiijiihjjkkkkjjjkkhklklmlklllmnmmonpnmnmmmpomosqqoqpqpqrqrrrrsqqpqrtssssstsrustututtvrttuuurtttutvwwwwwuvvuuuusrtrqrqsrqsnmloomlnlnm}~~}~~~~}}}|}|{}|}|~~}|{{|||||z||}~}~~~z{zyxxvvstsqsqrrqqqpqpopqnnorotprrqpsqsvuwvwwtssqqqqmnonnnmnlkmmkllkjjkjjjihiihiijikljklkjmiijjikjjikjjjkmkkkijjkknmlnmllllonopnomnopponoonopnonoqosqoqqssssqrtssrsstssusurttsstrttuwwvuvuvtuutvvuvwwwwuwwwuuuststtsrrsrrqqpmppmmlknmk~~~~~~}}~~~}}}}|z{}|}}||}~{||||z{|||}}~~~|zzyyyyxwvtrsqprsqppopooqqppqopntrsrpssuuvwvutvsrspooommnopqpmmnoljljikkijikhgjiinljklkikjiihhikjkklkklkjjljjlkmknmplnmlnlmmnmonmnoonoqomnrqpqoortppptrrtsrrsrttttsrtsttutvutvtuutvuuwuwtuvvuutuuvuvuvvwwvwwwvvvuvtssqussssqqonnnmmmmlm}~}~~}}}}}}~}}|~||}|}|{|{z{~}{|}}~~zz{xzwvuusrpqqpqqpqponopppnqppqsrsrtrvyxxwtuttusooonomoopoqnlllkmlkijkjijjkkmkkljhhihiiiijijkllmmllmhkjkkilkkmmolnkmlmnlomnomnmnnoqopponnppoprpqspqssqtrtstsutuqssutuuttvvuuuvvwuvvuvvvwvwstvuuvvwwvxwwxvxwuvuuttstttsrrtpsmmonmlkpml}}~~~}~}}|~~~}~}}}}}~}}||||||||{||{||~~~|~|~}{yzyyyxuwttrsosroqopnopoponnmpprrrruttuwvxvuttstprnqpplomnnmnkmmkkkljmljllljjljjmjjljjilkkllkmllllkljjlillnlmomlkmnlmnonpnpmomononqpnonqooqrpqrqrqsusqrutssttsstttustutuvvvvtvwvvxwxwvwyxwwvwvvuvvvwwxxxxxvuwxvxutttustrpsrqommollnplk|{{}|}|}~}}~~~~}|}|}~}}}}|}}|}|~{||{||~}|}}~~~{{zzzxvvuusssrprppoppnpononoqpqsprstsvtvwvvwwtttspoooopmllmqmmpnloonlllmjnkkmjiikjjkljmlkkllkjklliklknklmnknmmmnklnoonnnmmonopnmnonmooospnooqsqqqtstrsssqsrttutrsttsuvuuwuvwvvxxyxxxwxxxyzzyyxyyxwyxyz{yxxyyxvywxwututsqtsrqmmknmmllko|z|{{|}~~~}~~~~~~}||}}}}}~~}}|}}|}~}~|~}}~|}~}}~|{zxyzxxwvurssporqopononnoooqnmpqsqtsutuvvvvvustssqppmqlmqprooqnllnlknljkklklnknlmlnkkkjjkjijmilmllnmnmmlmlnnmmomonnnlnmonlqooppnorpqoppqnnruporsvstsuttvuuvuuuvwwuwvuvtzxyzxxwyvxyxxyx{yzyzz{zxzxwzyyyzxxyywwxwwvuuuuuuutrqonmnmknmmk{{y||z}}||~~~~}~{}|~~~}}}||}}}}{|}~}~~~}}}||~|{{zywzwuuuurqsqpqqpqrnnnnnonmnppqrsttttttuxyvtstsrqpqnnlsrqopqmlmnlllmllommomlmnlmmjkkljlollnmppmlnmpmmkjnmoonooonpmpopqrpooppproprrpsosspstuprttutvvtwuwutwvuwwxwxxxxwxxzxxywxyxyzz||yz{}|}yzxy{yzzzzzxxxxxxwwwuuuuusrssrsmmmllmmnmk{zzz|z}~{~~~~~}z||}}}}~}|}}|||{|}}|}~}~~}}~}|||~}{{xywyyvxvurrprtpqoqpopononnopppqtsruuttuvxxuttstopqppplprolomllnomopnnpppoonmmnklmkkolnmomnonnnnnlmnmmmmoopoomnonpqpqrqppppqqqopqrrspppvsrtsusuuustwuwxvvwvwxwwwxxwxvxxyzzxyyyzyxyyxxxz|||{zxyy{z{{y{zyzxyzwxwwuvwtsttrsqqmnnnmlmllk}|{|y}~~~~~~~|}}~{}|}}}}~}}}}|{|}}}~~~|~~~~~}~}}~}}{~}{{xxvyyvuvrstoqspqpponnnonpprppqsrrottssuuuustrrqponnnmsprlpppnprqqopnpqnnnlkmmklqmppnpppmomlnmnnmnpmplproomoopooqoppoopprqpqpqrssqqustturpsturvuvxvxxwvvvwwwxxxwxzz{y{zyz{{{zyzyzz{zzz{||{{z|xyyzzzzyxyzzyzxvvwvtuttsrrqqlnloknmkkk}{}{{}}~}~}}|~}|{|}}}~}|}}z}}|}}}}~~~~~~}}}~}|~|||{{{{{ywxwuvurwtrrsorqoponnnnnooprpoqopsrrtustvuusrqonmmmonsrrpssqqqqqpsqppoooonmnnpropppmopmonnoonmooqqoplonlonpoqppqoopqqprqppqrrqtsqtrwvstuutwxuuuvxwxxxxwwxxxywy|yyzz{{z||{{{{z{zzzy{z}{|{{z{yy{y|zyxyyz||{|xxvvvvvurtqsrqkklmllkkkk||}}~~~~~~|}}}~~~}{{||}}|~|~}}}{~~~~~}~}~~}||{{|~{yzxwyuuuvutssrrqoqqponnoooooqtpoqqqprsssutussqprpnmmmottsptsoosooqqnoqqnorooqonqqmoomppmnrpqqnprooqpopnpoqpsqrqrorqsrsqqqqrrrpqtttsxvwsrsuusvvvxxyyxxywxxyxxyzyxyy|z{|y|z|}|}}{|zy{|z{z}y{zy{}|{}{yzzz|{y}|xwxuvtussstporlmmnmnkmkk}|}~~~~~~~~~~~}}|~|}~}~~}}}}~}}~~~~}}}}||{{zzzxxwvwuuutusrrrrqooqqnnoopppoopqooqrqrqtttttqpoopmklmkrrpqtppqsqporqrsrprronpnmqmlopoqspqprrrqopproosqrqqtqpopqqqrqsrrqrstsqqsrsssuvvvuutxwutvxvxyzyz{zzwyxxz{zxxy{{}{|{}|~zz}}z{}||}{}z}{|z|yx{|y~zz{{{|{{ywvuusuttsqpppllnlllkkkk}}~~~||}~~~~~~}}}}}}}~}}~~~~~~~~~~}~~~~~}}|{{}|z{{{xywvwvwvttstrqqopspnnoqpporppppnppqppqrrqrqppnpllommmqpmoqqnrqoqrqqrrpmpommllknnnpqptrqrrpqpnoqqsqssrurpqrsnrqtssrppqsusrsqussqvvvusvvxvvxuvxyyxyxyy{zyyyxxyyzyzz{|{{||}}{z|}{{{}}{}z|}zz|{{|}}z{|z{z}|~zywvvttuutrqprooklkmklkklk~~~}}~~}}~~}~}~~}}~}~~~}~~~|||}||zyyzzwywwwutvutsrqpoopqpooppnpppnpopqpqopppnqpmommmkllklmnpppuspssqprqoopllonmnqmnponqroqqpqooqrqpqqvsuustqrqqrssqrqrsrsssrrsutuuvuuwytstzxwuwvvyyyzyyz{yy|{z{{zy}}||{~}|}~~~}~||}|}{|{|~~}}~}|}|||{~|yz{z{{zyxuwuvvuquprrprknmlmnlkkk~}~~~}~|~}~~~~~~~~}}~}~|~~~|zzzxvvvvuvuutttqrqpqoopooopppqprnopqpppoonooonlmlmlkllllrrqswqsprpoqonopmmponrpopponooprqqrqqtstusqsrsrststrvtssrsrsttusrttvtvusyxyuxxywyyytvx{xxyz{|||z}|{}{~}|~||}~}~}~~~~~|~}~|~~{~~}||||||{{{{z{zzxyvwvvuutsssrqklkmllkllk}~}~~~~}~}~~~~~~~}}}~{zx{xvwwvwtuvtsurqpsqqrqpppooopppponppnonnnmnlnlllkimjklrsqornonnnnpporqpqrpqprnnolnomptqsusuuusvqtrqtrtutvstssqrstuvsssvvvtwxwuxzwvuxyxvxwww{{zwzy{{z|{{{~~~|}~|~~}}~~~~}}}}}{|}~}~~~~}{}}||||zyzzxxxvvxuuuusspqqkmnkklkkkj~|~~}|~~~~~~~}~}{{yxwwwuuuttuqrrptqqrpqqopoqpoopppnppqoonomnmlllljkkjjlpmmpoqopqopsqqsqoqromonnqnmoqrqutuvrsrsrsrttrtututtrsqttwtutttsuuutvzxvxwyvwy{{zvwx{wyzyw{|}{{||{}~|~{}|~~~~~}~~~}~}}{}}}}|}}~~}|{{zywxxuvuttssqrrqkllmklmlil~~~}~|}~~~~~~~~~}~||yzywvxutswurssprsrqpqprpppppqooopoponnmmnmmklkkiijkjnmmnsnpssrrrrnppnqnkmnonoposqrsurtrrsrrsvuvutusutvssvsvuvtvuvvvuwuwxwxxxvxwyyxyxwx{|{xxy{z||||||~}|~~}~~~~~}}}~~~~~||~~{{{xyyyxxvuttssrrrqqkkmnkkkllk~~}}~~~~~~~||{xwyxxwututuurtssrqrqqqrprooppopnpooomnnllnkkjkikjkkrqosurptrqqrmnqnmpqnoqpqsrqrrprrrturtutvvsxtvtrurtuwxwvutuuvyxwuw{xxxyy{vwzy{xxz{y{z{ywz{{|~}||}~~}~}~~~~}~}~~}~~}~}~{~{zz}z{yxywxttrstsppqjkkllkmlkk~~~~~~~}{{yzywxvttuvspqrsrrrqrprqqpppoqpopnoolnnmllkkjlkkjjkkrqpruqorpnqqmnqqqstqprrossqspprssuuuxtuvuuvsussxwywwwuuvvtxyxwu{zvxzxyxz|zz|{xx{}|}y||{|}z~~}|~}}~~~~~~}~~~{}z|zzyyywvutsrrqsrpkklolllkkk~~~~|yyzvvuwvwwrsstrqsssrrqqqqpqoopqnnnoooomlmmkllkkllijirmoqooqqspssqrsqrusqopnoqomprptstuvtwtswrtvtuux{uxvvtutsxxzxxxzywzzy|{z{}~zz{|y{}}yx{{{{||~~}~~~~~~}{}}zyzxxxwvvvsrrsqqpilknkkkjjk~~~}}{{zxwxvvwuwwvtttsurrsqpqssppppppqnponnnmnnmknklkkkijjomlqspsssrvurqrrornnpnonsrrussuusuutvsuvtuwvwuvvtwuxwxyyvxwxy{zz{yz{{{{z~|yxy}}|}{{|{{}~}~~~~~~|{{{zyzxzwvvuvqqrqqqkkjkkkkkkj~~}|{zzxxwxvvusutusrtspssrqsqqpqrqppppoonoonnmmlkjkkljlkirnpssstuspsrqrpmoqpoornrspqurprrrstuvuwwuxxuusussww|y{zxwyzy|{z{z{{{}}||{|{y|~~{y{}|z}}{}~~~~~~|~|}{|xzxzxwuutstqrqplijkkjkkki}}~}{zzvzvyxvwsvttsrssssssqppqsrppqpqonnooonnomlmllkkkjklsrqtuqrtoospmppnospquroruqrsprsqtwvy{zzxvvtvusxvzwx{xxuxvzz~{{{|{|}||}~|z{}|||}zyz~z|~~~}}|{{z{y{ywyxxsssrtrqjiikkjkjji~~~|~yzyyyvyvvtuuvvtttsqtrprtqoprppporpnoooonpnnmmlllkjjjlroqsnorrqorrpsqqsvqrrsoqrqrsrqusvywzyuwvuvuvvw{vxyyzvzw|{|}}{~~{}|}~}}||{z}|~|{~{~~~|}|||{xxzyvwvuutsrjjjkkkkkij~|}{zy{xwwwvutuvtrsststqrqqsqrrqppoppoqopnmnmnmmnkkmkklnmortoqtrsusrtsoqrnoqomrsrstrwwsvyuxwxvvwxvxzxxwvwy|z||~{|||~~{~|}~|~}{|~~|{|~}~}~~}}~{z}{xwwvvstutsjjkhkjlkkh~|~|{|z{xwxvututvttuqsrtsrqqsrrqrqrpoopnpoonnnnnkmmllkkjrorsrsvursvrprnnqplorppswtvvstvsuttxxwzwy|vyvwvvxz{|}~|~z}{~~}}}}~~|{~~~}~~|}}~|}|||{{{yzzyvvttvskiiiilkkkk~}||{{{{wyyttwuvwtssturtsqqsssrrqrrpponoppnsnnnnlnllmlkltquvrrtsosqnprooqtortssvustsqussvww|xz{xxyuywzyy|z~}|}{||~~~~~|~|~}|}|~}~}~~~~}~}}}|||zvyvyvwvvskkkjjjljjj~~~~}}{|zxxuvvtutwtutrtutrsrrqqrrqqrqqppnnoopnonnknnkmmlntpstrrtrorsoqttsvvrturovopqtptut{xz|{{zw{xx|z~{}~z|y{zz~}~~~~~}}|}~~}~|}}||{yzxxyxuwvklkijkmkkj~|~}|}|x{zxvvvwtwutuvrsurtuqrssqsrqqspqonppoppmmnllmnmlmnqotqoorrqttsuvtrurprqnpspqtuvzwv{xyywy{x||}}{~}zzx}y}}~~|~}~~~}}}~|yzyxyyxwwwwkkkkkjkkkj~~~}~}|}{z|y{xxyxtustuvttsststtsssstsrqsqporpomponomnnlmlmnqqtusuuutwwssspqrnnqqortqsvutyvvwuwywzzzz|y{|zz{y}{~}~|~~~~}~~~}~~}}||yy|zzxxtnmkljklkji~~|}~}}y{{xzyyvuvvsuxuutsstqrstsspsrrsrrqqqpnonnonpomnmonttxwttvtrtporrorrppssqsusquqsusuwtxzyzzxzyzyy|z|}~|~|}|}~}~~~}~}|||{{zxywxmonmkmjlkj}}}~}}}{{{yzyxyvvuxutvtuuutssustqtrqqrrrppppqqonnpmomnnmmvuxvprtoqusortqtwqsvurrtoqsortvwyvz{wwvvvsyz{}{}}}}{}z|~~|}}~~~}}}|{{zyy{zponmmkkjlj~|~}|}{{z{x{vzwuwyvtvxvttsttuusttrqrrrrsproporopooooonnossuqqrsqsuuuxvruvsotpoqroqspuzuy{uuutvruxwzy{~z}{}|y}{~~~|}~~}~~~}{{z{yyvpnnpnlkkjk~~~~~}~||yzzyyxxxwwttvttsvtvtststrusrqsqqqppsopmmoppoponnpsuurtvswxvtwsorrnorqopuqsxrwyuvwqvssvvyyvzwwyu{x~||}~~~~}|~}{~~~~~}}||zzyzzmomnmmklok}~|}{{z{wywwxuxuwuwtrvvttutttvttrssqsrqsrqpropppponnnsuxuuxxsrtprtqptsoqtssxwsuwssuqtustvuyuy{uxuwwv{~|y{}}~}}}|{}~~~}||{zzxonmlllnllk~~~}|{{{zzxyzwwwuxvvtutvsttssrstrptqossrsqrrrporpopnomxyyvtwsqsvpstsrvvtvwwuyvqssostruwvxuxyvyvvzwz{||||}|}}}~~~}|}z{|zzqpnnnlnkjm}}~~||{{yzyyzxuwuvxvvrwttuutrttsrqqtspposorrqqprqonnntuwrqvsrtxtvxuuywtutrrvrorqpsus|yvxuuwrwyy|{~}|~}~||~}~~~||||zzzpnopmlmkkm~}|}{y|zyxwxyvvvtusuvvuurrtqrrstsqqrsustusqqoppqqqoorxxttxwuyyuxyurwrqtsssvwrxvtwxsxvtvquvv{{}~z~|}||{~~~}~||{ponplmmmmm~~}}|}z{|zzyxvwutuutwtvuvssusuttrutuutttssrsqrqqqosovw}v||zuxxstuqrurquuuw{vxzyrvtsurtxtw{y~~~|w{zy~~{~}}~}~}{|{znqnonmnlml~~}|||{{zzxvxuwxuvusttstvstvpsrrspsstusssssrrqqqrrpnz}}wwzvrxsrswrv{vuzztvxvswrrvrsxvv|x{{w|z||z{|~|~{}y~~~~||}|{|onroqpmpnm~}}|z{z|zywxxuvuvvsussurrvssustqsutsstrutstqrqqrppqw|wsvvtrvvswywy{vuwvstuvsusswwvxyy|vxuv{{}~{}|x{|~~{}||}~{}|~}|}{qrnpnopmon|}}{|yxzwuvuuvvvuutwsvtsrrtrwvvtustqsssrsspprqrrqvzwst{wxzxw{zvx{stwtrvwuvxxw~wz}xwxtxwv}|~~||wy~}{{|~}~}~}~~||{||ppppoopomn}}}|{{x{zyxvxwutuutxvutussrusvsrtuttvsqurrrstussrrsy|~w~}yy}{vyxrvwqtwwu{x}~z|~zvwtvxty{||}{||w{{}~}||z}||~|}~~~~~|}~}||qpoqopomop~~~~||{{{yywzvvvwtxtwvuuvssttrstvuwtttssrsstrrqpqqrq~~{x||wvzutywqu{wz|z{{{~yxztvxuz|x}{|xzw{{z~~~{~}~}~~|}{}}~}~}|}~~~|yrrornoopop~~}}|||{zzxzxxwuwvvtvvvvuuruvtsustutttrrvrqtsrsqrssr{{v{wtv|vwz{y}zy{x|yuxzty{wx}x{}x|xxzv{y}~|}{}~~~~~~||}|{z|}}~|}}qqrrprpqpp~}~}}||zz{yxyyxwvwxvwvuuwtvssstvuustsssurrtrqssqtrrryzvxx|vz~|||{}|vx}vw{ywx|w~|zzyx|vx}|~||yz~~~~}}|{}}|yz|~~~}~}~}}}qrrqrrqppp~~|}~}}|{{{{zyxwyxyvvxwvvwuxwvuwxvuvvturtsuttrurttttty}z{}~~}y~yv{wsx|wz~~{|}||w{wx|z|}}w{~}|~}{zz{~~z~~~}}~~}|~}qsrpoqporq|~}}}}z{yyzwyyxxyxzyxyxwtuwuvwvvvwvwvuttusrsttuuttts|~}x}~uwzvwy{v||}|{||vzxu|}~~|zz}|~||}{~~zz}|}}{~{||z|{y|~~~~~~~qrsqqqqqpq|||||{{{{{zyzyyyyywxyyyywxwxwxvvxvwtvuuutwsuututttu~zxuz|uy|{{~}|{~yzw||w}|}}y~z|~}}}|z~|z~{y{~|zx{{xyxzz{~}~}~~}}~}}srqsqoqpqr}}}|{z||{|{zzzzzzyxyyxyxyxxwxyyxvwvxuuvvsvsstvuvtttt}}w{|yw{~y|}~|}xz~yy||~|~{|x}{~||~yz||{{{y~xxxyxwxxxwy~~}z}}{|z~~|~|}qrrtrrrqot~~|}~}}{|z{z{|{|zzzyzzzzzyxxxxwxwvwwvwtvtuvutvuuutuu}}z|~}}~}zx||x{}y}x}}~}~|z|~{ywy~{{{suzyyyxyvyy~~~~|}|{{{|{}tspqrqsprq~~|}{{{{{{|z{|}|{|{z{{{|yyzxxyxxxxvwuvvvvvutuuuttut|{z|w|~{{~}{~zx}|}{}|~xwy|xxwu|wyxwxw{|||~|{{{xzz|}}~ossrrprqrs~~}|}{|||}{|~}}}{{|{{zzyxyyxxxxxwywwvwvwtuuuvuuty}|yy}z~|z{~}~~~}|}~~tzwxz{yruwywvxxxyz||}~}||{yxxzyy{~~~rqqrqqsrqq}|{||{}{|~~}~~}||zz{z{yyxxxxxywvwxvxwuvvutvvuv{~z|{||~z~{{}~ztuz~{wxvu{xtwxxxyz}||}}|||zzyy{y||~}~qrqqrpsqqq~~~|}{|~~||}}||{{z{zyxxxyxyxwxywxvvuwwvwww}}|{}|~|~|}y~yzzzwz~xquzxyuryxxwxz}|||}}|{zzyzxyz}~}~~~~~~qrsrprpqqq~}}||~~}|||||||{yz{yyxxxzyyyxxxyxyxwvxwwx~{y}~}~~}|z}vsz}yvxwru|xsttwxxxwxzz|||||{{{{zzy{{|}~}~~~~spqrqrqrqq~~~|~|~|}zzxwzyz{yyzyxyyyyywyxyxzxy|~}}|~x|~x{{uuxzw{yorxvywxxyzzzy|}~{|{||{}{{|}~}~~~rsrrrqnssr~~~~~|{{z{{}zz{{zz{{yzyyzyw{yxyw{~}z{{~|{|tsyzswtw{uzxwxvzyxy{|||||{||{||}~{{qsqrsrpsrr~~|{||zzzz}{{}}|}z|{{zzzy{{{y{z}{~~w{{wz}xqtywwtyyyxvxxzwy||||}}}|||~}~~~rssrqsppqr~~~|}{z{y{~}{~~}}}}}|{|}z}}}}}}|{zvz}}wvxrvzvtvxwxxtxy{zz{||}{{|{{{{}~~~~~~~~~sqspqrpsrq~~}}|}|z|}}~}~~~}~}}}y}|{~|}|srxzvytsxvxywxxxywz{|||{{{z|}}{}}~~}}|~~~qpossspsrs~|}~~}}~|}~xz}x}vt|}xvwwzxzxyywyx}{}|}}~~||}}~~~~~~~}}}~~~srqrqqrrrt~~~~~}}|}|{ruxwy{tpwzvxyyyzyz|z{||}}}}||||}~}~}~}{|{}~~~rrqprpssss~~{|u~}|xtw~~wvwszzwzyy{zy{z|z|{~{}}}{}|~~~|~~}}}}}}}~rrrqrpqrrsy|zvv|{zz|qs{zwur{yx}z||{}|||}|||}|}}~~}~}~|~z{}~~ttptqqsqtu~|z~z~ys{}uxuu~~uvy|z{{}{}{}|||~}|||}}}~}}}~~}}~~|||||~}}~}~ursrqssqrp~z}~{wyy|yrs||z|sv{z|zz|{|y|||{}|{|}}|}||}|~~}~}|}}~}~}}}||~~trrrsrrsqsw{zuzzz|uw}uuyy}y}z~|{~|}}|~}||||}}}~}}}}}~~~}~}}}~~~}|||~~}~|~rrrrtrrrqs{xzz}vvz~{~{rw}{zy}|}|~}~~~~~~~}}~~~~~}~~~~}}~~|}}|~~stqrrsrqst~~x}~x}y{xu~~vzwx~{w~~|}}||~~~~~~}~}~~|}~~~~~}}}}~}~}~}}prrstssrsr~~|vz||~zvz}{ty|{xx~}}|}~~~~~}}~~~~~~}~|}}~}}~}ttrrsstrppz{}||v}~z|}x}y{~y{~~~~~~~~~|}~~~~}|~}}}}~}ssrrtrrrqq||z{}}vu}}{{v}}~~~~~~}}~~~}}~proqrrqppnzv}{}|w~~x{}{~~~~~}}~}}~~srrrropqrpy}w}{vy~{w}~~~~~~}}~}~~tqprsoqoonx||~{~{|}~~qqqspprppp~}zyw~~~}~pqooqnorop{|y}}|qpqrppoopo endstream endobj 113 0 obj << /Type /ExtGState /SA false /SM 0.02 /OP false /op false /OPM 1 /BG2 /Default /UCR2 /Default >> endobj 116 0 obj << /Type /Page /Parent 70 0 R /Resources 118 0 R /Contents 117 0 R /TrimBox [ 36 36 456 631 ] /CropBox [ 36 36 456 631 ] /ArtBox [ 36 36 456 631 ] /BleedBox [ 0 0 492 667 ] /MediaBox [ 0 0 492 667 ] >> endobj 117 0 obj << /Length 4907 >> stream BT /G4 1 Tf 8.55 0 0 9.5 78.735 565.01 Tm /Cs7 cs 1.000 scn /GS2 gs 0.1228 Tc 0.0000 Tw [<08300ca5144c03a50374>112.3<05f805d403de082202ae0321>]TJ 11.7895 0 TD 0.0000 Tc <0080>Tj 0.6737 0 TD 0.0105 Tc [<0098144c0374>-112.3<05d40099>]TJ 4.8281 0 TD 0.0000 Tc <0081>Tj 0.6737 0 TD 0.1228 Tc [<0bf40e3806100339>112.3<0c19>336.8<0080>]TJ 5.7263 0 TD [<0098>112.3<0bf40e380610>112.3<0099>]TJ 4.8281 0 TD -0.2140 Tc [<00810298>-336.8<0924>-224.5<040d>]TJ -28.5193 -2.8295 TD 0.0892 Tc <0bf40e380610025707890a6d03de09f704b30f1f082c1388029802ae032103fe0ba3036d02980253084803390c19006602c8054903af0bf40e380610026a>Tj 33.7663 0 TD <0339029802ae032102e1>Tj -33.7663 -1.4147 TD <0db203de0f4005bb07ae043b09be137d0064037502e10db20f6b0cbb034a05380e50043b006603e4032e006403af0bf40e380610026a0339029802ae0321>Tj 33.7663 0 TD <03750319099003aa0549>Tj -33.7663 -1.5158 TD <0e2d133305cc122f02bf0f080d0302ae03210ebe14040e380a15029804110e3805d00a37089503fe0a6d03de082c1388006603de0e0804b30f1f0298025b>Tj 33.7663 0 TD <027b13d0141d0f060f08>Tj -33.7663 -1.5158 TD <0d0302ae03210298119103af082c13880064052813d00ebe0f4011320e1005740f09029803fd1147071d02d9042a030804b30f1f04d4059b00660bf40e38>Tj 33.7663 0 TD <061002980f3009f7082c>Tj -33.7663 -1.4147 TD 0.1089 Tc <138802bf054902fc0924040d068c036a0bf40e3806100f30124703a50a590e3802bf054902fc0f1f0b0904b30f1f066b0066>Tj 0 -2.9305 TD 0.0892 Tc <035f05f50bf40e380610026a0339029802ae0321166e0e2d133305cc122f006403af0bf40e3806100d6f122d029815c7054e031909900e360f3003af144c>Tj 33.7663 0 TD <037405d402f406100d6f>Tj -33.7663 -1.5158 TD <122d029815c7054e05d505610f30027d029803390c19062a0a17082c13880064039d08db0ccc062c06ad15c703af0bf40e3806100d6f122d029815c7054e>Tj 33.7663 0 TD <0e3603de09f707740bb7>Tj -33.7663 -1.5158 TD 0.1097 Tc <0d8e029803390c190066>Tj 0 -2.8295 TD 0.0892 Tc <0bf40e3806100cef04310f1f08d8029802f408050bc408b0078903af144c037405d407890bf40e38061003fe0ba30298029d144c10631063082b026a030a>Tj 33.7663 0 TD <0cee0066026a033902ae>Tj -33.7663 -1.4147 TD <032102e10db203af12ae0c1c0738059b0c1c0bdd030a0cee02f90c9b02ae043105de16a30f1f08d8006603aa03e4006403de0e0804b30f1f0298025b027b>Tj 33.7663 0 TD <13d006210e08006405be>Tj -33.7663 -1.5158 TD 0.1228 Tc [<0d030db2>112.3<1261168e>112.3<0bf40e38>112.3<06101063082b>]TJ 9.3193 0 TD 0.0252 Tc [<0080>127<35a735a735a7355e3598359b35973595359d355e3593359f359d>80.5<0081>]TJ 9.4316 0 TD 0.1228 Tc [<006402f8>112.3<06a9055f>112.3<0a7b0bf4>112.3<0e380610026a>112.3<03390cef>112.3<0411025b0298>112.3<0bf00e2d>112.3<0f1f08d8>112.3<0066>]TJ /G3 1 Tf 8.55 0 1.7955 9.5 78.735 343.25 Tm 0.0892 Tc <144c037405d40fc103490c1c0453029802ab08990e3f0294080b0baa00640fc105490e5f11bd05cc05d0048112c605cc037502940cef068c0382041e144a>Tj 33.7663 0 TD <05fc0064052805fc11bd>Tj -33.448 -1.5158 TD <068c036a0e3f02940e360c3103490c1c0453038c0bc505d00382041e0bc502b102ab089903fe0b2a035b05d003aa083f13600f080d0302ab089903fe02cf>Tj 33.7663 0 TD <07e702980382041e0e26>Tj -33.4268 -1.6168 TD 0.1095 Tc <033005d512c40382041e0baa03820066>Tj 0.6579 -3.1326 TD 0.1228 Tc [<03490c1c>112.3<045302980f1f>112.3<08d80257>112.3<136d0e6b144c>112.3<037405d4>]TJ 12.5754 0 TD [<0090>112.3<0bf4>112.3<0e38061015c7>112.3<054e026a0339>112.3<0b9d06c6>112.3<0091>]TJ 10.8912 0 TD 0.0000 Tc <0080>Tj 0.5614 0 TD 0.1228 Tc [<0098>112.3<0bf4>0<0e38>112.3<0610026a0339>112.3<0b9d06c6>112.3<0099>]TJ 9.0947 0 TD 0.0000 Tc <0081>Tj 0.6737 0 TD 0.1228 Tc [<03fe030a>112.3<0f310064>112.3<03d9>]TJ -33.457 -1.6168 TD [<03af0c64053603de>112.3<15eb0a700a040a3710e70a9b067003de>112.3<082202ae0321>336.8<0080>]TJ 16.8421 0 TD [<0098>112.3<034902ae0321>112.3<0099>]TJ 4.8281 0 TD 0.0000 Tc <0081>Tj 0.6737 0 TD 0.1228 Tc [<02980f1f08d80066034902ae0321>112.3<03a20ee8052b>336.8<0080>]TJ 11.3403 0 TD 0.0105 Tc [<00980ee8>-112.3<052b0099>]TJ 3.7053 0 TD 0.0000 Tc <0081>Tj 0.6737 0 TD <15f4>Tj -37.7448 -1.5158 TD 0.0892 Tc <0c3103490c1c0453038d039d02bf0848043905d512c4038c0bc50baa03820064052803af042a0308025302b203a50b23075f0f14071d11bd10a900640c31>Tj 33.7663 0 TD <05be0d0305d4065d02bf>Tj -33.4268 -1.6168 TD 0.0994 Tc <05d406a6006a00d1>Tj /F-5 1 Tf 8.55 0 1.8174 9.5 116.175 238.61 Tm 0.0289 Tc (\(1\))Tj /G3 1 Tf 8.55 0 1.7955 9.5 127.695 238.61 Tm 0.0994 Tc <03490c1c045305d40f3102980f1f08d803af03a20820027d02d908260469166e0e5f11bd048112c6006402f20ccc10ac12ac03d303850069>Tj /F-5 1 Tf 8.55 0 1.8174 9.5 390.735 238.61 Tm 0.0289 Tc (\(2\) )Tj /G3 1 Tf 8.55 0 1.7955 9.5 404.175 238.61 Tm 0.0000 Tc <0349>Tj -37.7236 -1.6168 TD 0.1057 Tc <0c1c045305280ccc1372100d054902fc052b0fbc07e7053403490c1c045305d40f310382041e02ab08990b2a035b10ac12ac006902bf>Tj /F-5 1 Tf 8.55 0 1.8174 9.5 334.095 223.25 Tm 0.0288 Tc (\(3\) )Tj /G3 1 Tf 8.55 0 1.7955 9.5 347.535 223.25 Tm 0.1057 Tc <03490c1c045305d4068c0f3a0298>Tj -31.1203 -1.5158 TD 0.1090 Tc <025302b20e08050802570ebe11320e1005740f0903fd1147071d059004110cef068c0064052802f802ae033b03a50b2302980a3f0e5f02bf09ff0ba30789>Tj 34.3789 0 TD <053112bd0066>Tj ET endstream endobj 118 0 obj << /ProcSet [ /PDF /Text ] /Font << /F-5 41 0 R /G3 43 0 R /G4 50 0 R >> /ExtGState << /GS2 121 0 R >> /ColorSpace << /Cs7 119 0 R >> >> endobj 119 0 obj [ /Separation /PANTONE#202685#20CVC /DeviceCMYK 120 0 R ] endobj 120 0 obj << /FunctionType 0 /Domain [ 0 1 ] /Range [ 0 1 0 1 0 1 0 1 ] /BitsPerSample 8 /Size [ 255 ] /Length 671 /Filter /FlateDecode >> stream H Զm۶m۶ڶm۶mۚs! С a H(hQщX18xqID IIIII)IIiɐɔ̚lɞYə\ɝ<9ɛ|ɟy)B)\")Zb)QE)U)S%)WPeTRVYZU]:թ[z5_iXFui\&iڀf iވilՄMiӌiׂ-ЊԆmҎցщՅ>]ۍ~߃=؋A܇!}ڏa>9Q=1C1a8G0i$G1e4S0m,1c<3'0k"'1g2s0/8* p:fx&Kft6|.+r>z!kv1떰~)i9We%[Wm5װc-;ױk=7g#{7o3p`+q(xx;Gvpt'vq|7'pr/qz?gp q0p(q8WWOp$Oq47p,q!1)_9^c_^~{=~௏>o/c endstream endobj 121 0 obj << /Type /ExtGState /SA false /SM 0.02 /OP false /op false /OPM 1 /BG2 /Default /UCR2 /Default >> endobj xref 0 122 0000000084 65535 f 0000000016 00000 n 0000000251 00000 n 0000000419 00000 n 0000001331 00000 n 0000001351 00000 n 0000001586 00000 n 0000001777 00000 n 0000003590 00000 n 0000003611 00000 n 0000003848 00000 n 0000004040 00000 n 0000005340 00000 n 0000005362 00000 n 0000005600 00000 n 0000005792 00000 n 0000007333 00000 n 0000007355 00000 n 0000007593 00000 n 0000007773 00000 n 0000009678 00000 n 0000009700 00000 n 0000009938 00000 n 0000010107 00000 n 0000011954 00000 n 0000011976 00000 n 0000012214 00000 n 0000012394 00000 n 0000013988 00000 n 0000014010 00000 n 0000014248 00000 n 0000014428 00000 n 0000016112 00000 n 0000016134 00000 n 0000016372 00000 n 0000016552 00000 n 0000018255 00000 n 0000018277 00000 n 0000018515 00000 n 0000018695 00000 n 0000020155 00000 n 0000020177 00000 n 0000020958 00000 n 0000021099 00000 n 0000021239 00000 n 0000021363 00000 n 0000021438 00000 n 0000021496 00000 n 0000022332 00000 n 0000022891 00000 n 0000023676 00000 n 0000023815 00000 n 0000024055 00000 n 0000024352 00000 n 0000054408 00000 n 0000054647 00000 n 0000055156 00000 n 0000170646 00000 n 0000170884 00000 n 0000171253 00000 n 0000218661 00000 n 0000218879 00000 n 0000245905 00000 n 0000246133 00000 n 0000274184 00000 n 0000274512 00000 n 0000274706 00000 n 0000275089 00000 n 0000275181 00000 n 0000275288 00000 n 0000276637 00000 n 0000276759 00000 n 0000276833 00000 n 0000276897 00000 n 0000276920 00000 n 0000276972 00000 n 0000277038 00000 n 0000277093 00000 n 0000277142 00000 n 0000277178 00000 n 0000277255 00000 n 0000277322 00000 n 0000277456 00000 n 0000278360 00000 n 0000000114 00001 f 0000278470 00000 n 0000278640 00000 n 0000278787 00000 n 0000279025 00000 n 0000279256 00000 n 0000280043 00000 n 0000280119 00000 n 0000280260 00000 n 0000280401 00000 n 0000280477 00000 n 0000280553 00000 n 0000280612 00000 n 0000280843 00000 n 0000283385 00000 n 0000283407 00000 n 0000283648 00000 n 0000283843 00000 n 0000289155 00000 n 0000289308 00000 n 0000302690 00000 n 0000302932 00000 n 0000303523 00000 n 0000304112 00000 n 0000304672 00000 n 0000305488 00000 n 0000308681 00000 n 0000308825 00000 n 0000309021 00000 n 0001024213 00000 n 0000000115 00001 f 0000000000 00001 f 0001024338 00000 n 0001024568 00000 n 0001029530 00000 n 0001029690 00000 n 0001029767 00000 n 0001030604 00000 n trailer << /Size 122 /Info 81 0 R /Root 85 0 R /ID[<37555696fc33cc211d9d7ff90e1eaa07>] >> startxref 1030729 %%EOF